Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5j1 Olfactory Receptor

Gene Symbol Or5j1
Organism Rat
Family 5
Subfamily j
Pseudo No
Location chr3:74630948-74631883 (-)
Aliases Olr539, Olr539

Sequence information


Nucleotide sequence

ATGGCAAATGTCAACTTCACATTTGTTACTGAGTTTATCCTTTTGGGACTGACTGATCGT
GGTGAAATCAAGGTGTTTCTCTTTATATTGTTCCTTTTGATCTACGTCATTTCCTTGGTG
GGAAATCTGGGACTGTTTATGCTGATCCACATAACTCCCAAACTCCATACACCTATGTAC
CACTTCCTTCGCTCTCTGTCATTTGTTGATGCCTGTTATTCATCAGTATTTGCACCCACA
TTACTACTGAACTTCTTTGTTGAAAGAGAGAGAATCTCATTCTCTGCTTGCATCCTGCAA
TATTTCTTGTTTGCATCACTGCTTACTACAGAGGGCTTTCTCCTGGCCGCAATGGCTTTT
GACCGTTACATGGCCATTGCAAACCCTCTAACTTACACAGTGGCTATGACAAAATTGATA
TGTGTTCTACTAGTGCTGGGTTCATGCTTAGGAGGGACTATCACATCATTAACACATACA
ATTGGCTTAATGAATCTGTGCTTTTGTGGCCCTAATGTCATCAGTCATTTCTTCTGTGAC
CTTCCTCCCCTGTTGAAGCTGTCCTGTTCTGACACCTCCATGAATGAACTGCTGCTTTTG
GTATTCTCTGGAGTCATTGCCATGACTACACTTTTGACTGTGGTTCTCTCTTATATCTTC
ATTGTTGCTGCTATTCTGAGGATCCGTTCAGCAGCAGGCAGACACAAAGCCTTCTCTACC
TGTGCATCCCATCTAACAGCTGTCACTTTATTTTATGGTTCTATCAGCTTCAGTTACATT
CAACCAAGTTCTCAGTACTCCTTAGAGCAAGAGAAGGTGGTATCCATATTTTATACCCTG
GTGATTCCTATGTTGAATCCACTGATTTACAGTTTAAGGAACAAAGATGTAAAAGATGCT
GTGAAAAGAGTTATAGAGATCAAACATTCTCTGCAT


Conceptual translation

MANVNFTFVTEFILLGLTDRGEIKVFLFILFLLIYVISLVGNLGLFMLIHITPKLHTPMY
HFLRSLSFVDACYSSVFAPTLLLNFFVERERISFSACILQYFLFASLLTTEGFLLAAMAF
DRYMAIANPLTYTVAMTKLICVLLVLGSCLGGTITSLTHTIGLMNLCFCGPNVISHFFCD
LPPLLKLSCSDTSMNELLLLVFSGVIAMTTLLTVVLSYIFIVAAILRIRSAAGRHKAFST
CASHLTAVTLFYGSISFSYIQPSSQYSLEQEKVVSIFYTLVIPMLNPLIYSLRNKDVKDA
VKRVIEIKHSLH