Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5j12-ps Olfactory Receptor

Gene Symbol Or5j12-ps
Organism Rat
Family 5
Subfamily j
Pseudo Yes
Location chr3:74624498-74625617 (-)
Aliases Olr538-ps, Olr538-ps

Sequence information


Nucleotide sequence

AGCTAAAACACCTGCATTTACTTTATCTAATAATGGGTATTATTAACAGAAAGCAAACTT
ACAGCTTATTAAACACTATAAACTTTTAAACTTTATTTACATGGCAGATGTCAACATCAC
ATTTGTTACTGATTTTTATCTTTTTGGGACTGACAGATCATGATGAACCCAAGATATTTC
TATTTATATTGTTTCTTTTGACCCATATGATTTCATCATTGGATAATATATGAATGTTCT
TTCTTATTCACACAACACACAAACTCCACATACTTATGTACCACTTTCTTAGCTGTTTGC
CATTTGCTGATGCTTACTGTTTTCAGTATTTGCACCCAAATGCTACTGAACTTTTTTCAT
AAAAGAGAGATTACCACATCCTCTGCATTCACACTGCAATAATTTCTGTTTTTATCACTG
CTTACAGAAAAGGGATTTTGCTTGTTGCAATGGCTTCTAACCAGTGTTTAGCCATCATGA
ATCAATTTCTCTATAGAGTGGCTATGGCTAAAATAATTTGGGTTGGGCTGGTGTTAGATT
CGTGCAAAGAAAGTGTAATCAATTCAGTACACATACAATTGGTTTAATGAAGCTATTCTT
CTGTGGGCCAAATATCATCAGGAACTTCTGCGATATTTCTCCACTGCTGAAGCTGTCCTG
TTCACACCTCCATTAATTGTTGCTTTTGGTCTTCATGACCATAATTGTTATGAGTACATT
CTTGACTGTGATGATCTCTTGCATCTTCATTGTTGCTGCTGTCCTGTGAATCCACTCAGC
AGCAGGTGGAAACAAAGACTTCTCTCCCTGTGCCTCCCATCTTACAGCTGGGAATTTGCT
CTATGGCTCTATCAGCTTCAGTTGCATTCAATTAAATTTTTGCTACACCTTAGAACAAGA
GATGGCAGTGTCACTCTAGTGATTCCTATGTTGAACCAACTGATTTATAGATTTAGGATC
AAGGAAGCAAATGACACTCTAAAATGGCTTGTGTTGATTTATAACAATGAGACAGAAAAA
ACTGATTTAAATAATATCGTTTATAAAAAATCAGTAAGGCTAAAAATAATGTATTTTAGT
GTTTCTAGAAGTGTAATTCTATGTGCAAAATATATATTCA


Conceptual translation

MADVNITFVTDF\FLGLTDHDEPKIFLFILFLLTHMISSLDNI*MFFLIHTTHKLHILM
YHFLSCLPFAD/LLFSVFAP/MLLNFFHKREITTSSAFTLQ*FLFLSLLTEKG/LLV
AMASNQCLAIMNQFLYRVAMAKIIWVGLVLDSCKESVINSV/HTIGLMKLFFCGPNIIR
NFCDISPLLKLSCSHLH*LLLLVFMTIIVMSTFLTVMISCIFIVAAVL*IHSAAGGNKDF
SPCASHLTAGNLLYGSISFSCIQLNFCYTLEQEMAV/TLVIPMLNQLIYRFRIKEANDT
LKWLVLIYNNETEK