Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5j3 Olfactory Receptor

Gene Symbol Or5j3
Organism Mouse
Family 5
Subfamily j
Pseudo No
Location chr2:86,297,800-86,298,800 (+)
Aliases Olfr1052

Sequence information


Nucleotide sequence

MATENCTVVTEFILLGLTDRAELKMMLFVLFLVIYAVTLLGNLGMILLIRITPKLHTPMY
FFLSCLSFVDACYSSVIAPKMLISFLVVTETISFSACIMQHLFFGVLVTTEGFLLSVMAY
DRYVAVVNPLLYTVSMSKQKCIMMVTGSVIGGTINSLTHTISLSKLSFCGPNIVGHFFCD
IPSLLILSCSDTSMNEFLLLIFSGVIAIGTLLIVFISYLLIALAILRIRSASGRQKAFST
CASHLTAVTIFYGTLSFNYIQPSSQYSVEQEKVVSVFYTLVIPMLNPMIYSLRNKEVKEA
AKRAIEMKSFSC


Conceptual translation

MATENCTVVTEFILLGLTDRAELKMMLFVLFLVIYAVTLLGNLGMILLIRITPKLHTPMY
FFLSCLSFVDACYSSVIAPKMLISFLVVTETISFSACIMQHLFFGVLVTTEGFLLSVMAY
DRYVAVVNPLLYTVSMSKQKCIMMVTGSVIGGTINSLTHTISLSKLSFCGPNIVGHFFCD
IPSLLILSCSDTSMNEFLLLIFSGVIAIGTLLIVFISYLLIALAILRIRSASGRQKAFST
CASHLTAVTIFYGTLSFNYIQPSSQYSVEQEKVVSVFYTLVIPMLNPMIYSLRNKEVKEA
AKRAIEMKSFSC