Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5l13 Olfactory Receptor

Gene Symbol Or5l13
Organism Mouse
Family 5
Subfamily l
Pseudo No
Location chr2:87949281-87950231 (-)
Aliases Olfr1156, RP23-24F19.14, MOR174-3, RP23-24F19.14, MOR174-3

Sequence information


Nucleotide sequence

ATGGAAGAGGTAAACTGTACCTTTATGGCAGAGTTCATTCTTCTTGGCTTTTCTGATGTC
CCAGAGCTGGCAATCTTTCTCTTTCTCGTGTTTCTTGTCATTTATGGAGTGACAGTCATA
GCAAACCTGGGCATGACTGTACTGATTCAGGTCAGCTCTCAACTTCATACTCCTATGTAC
TTTTTTCTCAGCCACCTGTCATTTGTGGATTTCTGCTATGCTTCCATCATTGTGCCAAAG
ATGTTCACTGATATTATCAACCAGGATCAAGTTATTTCTTACCTGGAATGCATGTTACAA
TTTTATTTATTTTGCACTTTTGCTATCACTGAAGTCTTCCTATTGGCTGTAATGGCCTAT
GACCGCTTCGTGGCCATTTGTAATCCACTATTGTACACTGTCATCATGTCCCCAAAGCTC
CGTCTTGTACTGGTGTCCTGTTGCTACCTCTATGCATCAGTGTGTTCTCTAATTCACCTG
TGCTTGGCCCTTGAGATCACATCATTTAAATCAAATGTGATTAACCACTTCTTTTGTGAT
CTGCCTCCTCTCTTAAGTCTTGCTTGCTCTGATGTTAGTACAAATGAGTTTTTCCTGTTC
ATCATTGTCAATTTCAATGAGATTCTCACTATTGTGATCATCTTCACCTCCTATTTGTTT
ATCCTCATCACCATCCTGAAGATGCGCTCTGCAGAGGGGAGACGCAAAGCCTTTTCTACC
TGTGCCTCCCATCTCACAGTCATCATGGTCTTCCATGGAACGATCCTTTTTATTTATTGT
CAGCCCAACTCTGGTAACAGTCTAGATGTTGATAAAGTGACTACAGTTTTCTATACTGTG
ATCATTCCCATGCTGAACCCCCTGATCTACAGTCTGAGGAATAAGGATGTGAAAGAGGCT
CTTAGAAAAATGTTAGGCTCTAAAAAGAATTCTTTACTAGATTTCTTTTTT


Conceptual translation

MEEVNCTFMAEFILLGFSDVPELAIFLFLVFLVIYGVTVIANLGMTVLIQVSSQLHTPMY
FFLSHLSFVDFCYASIIVPKMFTDIINQDQVISYLECMLQFYLFCTFAITEVFLLAVMAY
DRFVAICNPLLYTVIMSPKLRLVLVSCCYLYASVCSLIHLCLALEITSFKSNVINHFFCD
LPPLLSLACSDVSTNEFFLFIIVNFNEILTIVIIFTSYLFILITILKMRSAEGRRKAFST
CASHLTVIMVFHGTILFIYCQPNSGNSLDVDKVTTVFYTVIIPMLNPLIYSLRNKDVKEA
LRKMLGSKKNSLLDFFF