Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5l13 Olfactory Receptor

Gene Symbol Or5l13
Organism Rat
Family 5
Subfamily l
Pseudo No
Location chr3:76085021-76085971 (-)
Aliases Olr601, Olr601

Sequence information


Nucleotide sequence

ATGGATGAGGTAAACTGTACCTCTCTGGCAGAGTTCGTTCTTCTTGGCTTTTCTGATGTC
CCAGAGCTGGCAATCTTTCTCTTTCTAATGTTTCTTCTCATTTATGGAGTGACAGTCATA
GCGAACCTGGGGATGACTGTGCTGATTCAAGTCAGCTCTCGTCTTCACACTCCTATGTAC
TTTTTCCTCAGCCACCTGTCATTTGTGGATTTCTGCTATGCTTCCATCATTGTGCCAAAG
ATGTTCACTGATATTATCAACAAGGATAAAGTTATTTCTTACCGGGAATGCTTGATTCAA
TTTTATTTATTTTGTACTTTTGCTATCACTGAAGTCTTCCTATTGGCTGTTATGGCCTAT
GACCGCTTTGTGGCCATTTGTAATCCACTACTGTACATGGTTGTCATGTCCCCAAAGCTC
CGTCTAGTATTGGTGTCCTGTTGCTACTTTTATGCATCAGTGTGTTCTCTGATTCACCTA
TGCTTAGCTCTTGAGATCCCATCATTTAAGTCAAATGTGATTAATCACTTCTTTTGTGAT
CTGCCTCCTCTCTTAAGTCTCGCTTGCTCTGATGTTACTACAAGTGAGTTTTTCCTGTTC
ACCATTGTCAATTTCAATGAGATTCTCACTATTGTGATCATCTTCACCTCCTACTTGTTT
ATCCTTATCACTATCCTGAAGATGCGCTCTGCAGAGGGGAGACGCAAGGCCTTTTCCACC
TGTGCTTCCCATCTCACAGTCATCGTGGTCTTCCATGGAACGATCCTTTTTATTTATTGT
CAGCCCAACTCTGGTAATACTCTAGATGTTGATAAAGTGACTACAGTCTTCTACACTGTG
GTCATTCCCATGCTGAATCCCCTGATCTACAGTCTGCAGAATAAGGATGTGAAAGAGGCT
CTTAGAAAAGTGTTAGGGTCTAAAAAATTATCTTTACTAAGTTTTTATTTT


Conceptual translation

MDEVNCTSLAEFVLLGFSDVPELAIFLFLMFLLIYGVTVIANLGMTVLIQVSSRLHTPMY
FFLSHLSFVDFCYASIIVPKMFTDIINKDKVISYRECLIQFYLFCTFAITEVFLLAVMAY
DRFVAICNPLLYMVVMSPKLRLVLVSCCYFYASVCSLIHLCLALEIPSFKSNVINHFFCD
LPPLLSLACSDVTTSEFFLFTIVNFNEILTIVIIFTSYLFILITILKMRSAEGRRKAFST
CASHLTVIVVFHGTILFIYCQPNSGNTLDVDKVTTVFYTVVIPMLNPLIYSLQNKDVKEA
LRKVLGSKKLSLLSFYF