Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5l14 Olfactory Receptor

Gene Symbol Or5l14
Organism Mouse
Family 5
Subfamily l
Pseudo No
Location chr2:87,962,000-87,962,900 (-)
Aliases Olfr1157

Sequence information


Nucleotide sequence

MDEENCSTVAQFILLGFSDVPELSGVLSLLFLLIYGVTALANLGMTALIQVSSQLHTPMY
FFLSHLSFVDFCYSSVIVPKMLANIFNKDKAISSLACMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYTAIMSSNLRMILVSGCYLCASMCSLIHLCLALEIPSFKSNVINHFFCD
LPPLLSLACSDVTVNKVLLFVVATFNESFSIVVIFTSYLFILITILRMRSVEGRRKAFST
CASHLTVIIVFHGTILSIYCSSTSDNSGDADKVATVFYTVVIPMLNPLIYSLRNKDVKGA
LRKVVNSKIYSQ


Conceptual translation

MDEENCSTVAQFILLGFSDVPELSGVLSLLFLLIYGVTALANLGMTALIQVSSQLHTPMY
FFLSHLSFVDFCYSSVIVPKMLANIFNKDKAISSLACMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYTAIMSSNLRMILVSGCYLCASMCSLIHLCLALEIPSFKSNVINHFFCD
LPPLLSLACSDVTVNKVLLFVVATFNESFSIVVIFTSYLFILITILRMRSVEGRRKAFST
CASHLTVIIVFHGTILSIYCSSTSDNSGDADKVATVFYTVVIPMLNPLIYSLRNKDVKGA
LRKVVNSKIYSQ