Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5l14b Olfactory Receptor

Gene Symbol Or5l14b
Organism Rat
Family 5
Subfamily l
Pseudo No
Location chr3:76,101,800-76,102,800 (-)
Aliases Olr602

Sequence information


Nucleotide sequence

ATGGGGCAGATGGTTGAGGAAAACTGCAGCACAGTGGCACAGTTCATCCTCCTGGGATTT
TCAGATGTTCCTGAGTTGAGTGGTTTTCTCTCCTCAATTGTACTTCTCATTTATGGAGTC
ACTGTCCTGGCCAACCTGGGAATGACTACACTGATTCAGTTCAGCTCTCAACTTCATACC
CCCATGTACTTTTTTCTCAGCCATCTTTCCTTTGTGGACTTTTGCTACTCCTCCGTCATT
GTGCCTAAAATGCTGGCTAACATCTTCAATATGGACAAAGCCATATCATTCCTGGCATGT
ATGGTCCAATTCTGCCTGTTTTGCACATGTGTGATCTCTGAAATCTTTTTGCTGACTGTG
ATGGCCTATGACCGCTTTGTAGCCATCTGTAACCCACTACTATATACAGCCATCATGTCC
TCAGATCTATGTATCATACTAGTGTCTGGCTGCTACTTGTGTGCATCAATGTGTTCTCTG
GTTCATTTGTGCTTAGCCCTTGAGATCCCATCGTTTAAGTCAAATGTGATCAACCACTTC
TTCTGTGATCTGCCTCCTCTCTTGGGTCTTGCTTGCTCTGATGTCACTATTAATAAAGTG
CTGTTGTTTGTTGTGGCTACCTTCAATGAGAGTGTTAGTATTGTGGTTATCTTCACCTCC
TACTTGTTTATCCTCATCACCATCCTGAGGATGCGCTCTGTAGAGGGGAGGCGCAAAGCC
TTTTCCACCTGTGCCTCCCACCTCACAGTCATCATTGTCTTCCATGGGACAATCCTTTCC
ATTTATTGTTCTTCCACTTCAGACAACAGTGGGGATGCTGACAAAGTGGCCACAGTGTTC
TACACTGTAGTGATTCCCATGCTGAACCCTTTAATCTACAGCCTCAGAAACAAGGATGTC
AAAGATGCTCTCAGGAAATTTGTGAACAATAAGATATATTCCCAA


Conceptual translation

MGQMVEENCSTVAQFILLGFSDVPELSGFLSSIVLLIYGVTVLANLGMTTLIQFSSQLHT
PMYFFLSHLSFVDFCYSSVIVPKMLANIFNMDKAISFLACMVQFCLFCTCVISEIFLLTV
MAYDRFVAICNPLLYTAIMSSDLCIILVSGCYLCASMCSLVHLCLALEIPSFKSNVINHF
FCDLPPLLGLACSDVTINKVLLFVVATFNESVSIVVIFTSYLFILITILRMRSVEGRRKA
FSTCASHLTVIIVFHGTILSIYCSSTSDNSGDADKVATVFYTVVIPMLNPLIYSLRNKDV
KDALRKFVNNKIYSQ