Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5m10 Olfactory Receptor

Gene Symbol Or5m10
Organism Mouse
Family 5
Subfamily m
Pseudo No
Location chr2:85,886,800-85,887,700 (+)
Aliases Olfr1023

Sequence information


Nucleotide sequence

MTFLNHTAMMDFILVGLTDSPVLGRILFVVFLVIFVITLAGNLFMIVLIRTNSHLQTPMY
FFLGHLSFVDICYSSNVTPNMLHGFISDQKTISYAGCFTQCLLFIALVITEFYLLASMAL
DRYVAICSPLHYSTRMSKNVCVSLVAFPYVFGFLNGLSQTLLTFHLSFCGSHEINHFYCA
DPPLIMLACSDTHVKKMAMFVVAGFTLSSSLAIILLSYLFIFIAILRIRSAKGRQKAFST
CGSHMTTVTIFYGTLFCMYLRPPSEKSVEESKVIAVFYTFLSPMLNPLIYSLRNKDVINA
MKQVVKGKLLH


Conceptual translation

MTFLNHTAMMDFILVGLTDSPVLGRILFVVFLVIFVITLAGNLFMIVLIRTNSHLQTPMY
FFLGHLSFVDICYSSNVTPNMLHGFISDQKTISYAGCFTQCLLFIALVITEFYLLASMAL
DRYVAICSPLHYSTRMSKNVCVSLVAFPYVFGFLNGLSQTLLTFHLSFCGSHEINHFYCA
DPPLIMLACSDTHVKKMAMFVVAGFTLSSSLAIILLSYLFIFIAILRIRSAKGRQKAFST
CGSHMTTVTIFYGTLFCMYLRPPSEKSVEESKVIAVFYTFLSPMLNPLIYSLRNKDVINA
MKQVVKGKLLH