Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5m12 Olfactory Receptor

Gene Symbol Or5m12
Organism Mouse
Family 5
Subfamily m
Pseudo No
Location chr2:85904072-85905052 (-)
Aliases Olfr1024, RP23-384L16.11, MOR197-1, RP23-384L16.11, MOR197-1

Sequence information


Nucleotide sequence

ATGAAGGCATACTCAGAGGCTAAGCGCAATGGCACTGAGGCAACTGAGTTCATTCTTCTG
GGACTAAGCACACGACCAGAGCTGCAGCCAATTCTTTTTTTGGTATTCCTCACAATTTAC
CTCATCACACTGACTGGGAACTTTGGCATGATCTTATTAATCAGGTTCACTCCTCAGCTG
CAAACCCCCATGTATTTTTTCCTGACACACTTGGCATGTGTGGATATTTTTTACTCAACA
AATGTCTCTCCTCAGATGCTTGTCAATTTTCTATCTGAGAAGAAGACTATTTCTTACATT
GGGTGTCTGACTCAGTGCTTTGTTTTTGTCACTCTGCTGTTAACTGAATATTACATGCTG
GGTGCCATGGCCTATGACAGGTACATGGCAATATGCAAACCCCTACATTACAGCACAAAA
TTGTCCCGGCCAGTTTGCATTTGCCTGGTTACATTCCCTTACTTCTGGGGTAGTATGGTG
GGCACAATGCAGGTGATATTGACTTCACGTCTATCCTTTTGTGGACCCAACACCATCAAC
CACTTCTACTGTGCTGACCCTCCCCTCTTGATGTTAACCTGTTCTGACACTTATATCAAG
CAAACTGCCCTCTTTGTGTCAGCTGGGATTAATCTTACAGGTTCCCTTCTCATTATCCTC
ATCTCCTACATTTTTATCTTCATCACCATCATGAGGATCCGTTCCAGTGAAGGGCAACGA
AAGGCTTTATCTACCTGTGGCTCACACCTGACAGCTGTTACTATGTTCTATGGTTCCCTC
TTCTGCATGTACCTGAGACCAGCAAATGAGAGGTCTGTTGAGCAAGGCAAAATTATAGCA
GTATTTTGTATTTTTGTGAGTCCCATGGTGAATCCATTTATCTACAGCCTGAGAAACAAG
GATGTGAAGCAGGCTCTGAGAAGAGTGTTTATAAGAAATCTCTGCAAAGTGGAGAAAAGC
TCAGTACCTATGCTGTCCCAC


Conceptual translation

MKAYSEAKRNGTEATEFILLGLSTRPELQPILFLVFLTIYLITLTGNFGMILLIRFTPQL
QTPMYFFLTHLACVDIFYSTNVSPQMLVNFLSEKKTISYIGCLTQCFVFVTLLLTEYYML
GAMAYDRYMAICKPLHYSTKLSRPVCICLVTFPYFWGSMVGTMQVILTSRLSFCGPNTIN
HFYCADPPLLMLTCSDTYIKQTALFVSAGINLTGSLLIILISYIFIFITIMRIRSSEGQR
KALSTCGSHLTAVTMFYGSLFCMYLRPANERSVEQGKIIAVFCIFVSPMVNPFIYSLRNK
DVKQALRRVFIRNLCKVEKSSVPMLSH