Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5m12b-ps Olfactory Receptor

Gene Symbol Or5m12b-ps
Organism Rat
Family 5
Subfamily m
Pseudo Yes
Location chr3:73,283,600-73,284,800 (-)
Aliases Olr467-ps, Olr9-ps

Sequence information


Conceptual translation

MKAYSGANHNGTEATEFILLGLSTQPELQPILFLVFLMIYLITLTGNFGMILLIRFTPRL
QTPIYFFLTHLACVDIFYSTNVSPQMLVHFLSEKKTISYIGCLTQCFV/VTLLLTEYYM
LGAMAYDRYMAICNPLHYSTKMPRPVCICLVTFPYFWGTMVGTMQVILTSRLSFCGPNTI
NHFYCADPPLLMLTCSDTYVKQTALFVSAGINLTGSLLIILISYMFIFVTIMRIRSSEGQ
QKAFSTCGSHLTAVTMFYGSLFCMYLRPANERSVEQGKLIAVFCIFVSPMVNPFIYSLRN
KDVKQALKRVFMRNLCKMEKS