Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5m13 Olfactory Receptor

Gene Symbol Or5m13
Organism Rat
Family 5
Subfamily m
Pseudo No
Location chr3:73302571-73303506 (+)
Aliases Olr468, Olr468

Sequence information


Nucleotide sequence

ATGTTAAAGAAAAACTACACAGCAGTGACCGAGTTTATTTTGTTGGGACTGACAGATCGA
GCAGAGCTTCAGCCTGTGCTCTTTTTGGTATTCCTGCTCATTTACCTCATCACGGTGACT
GGTAATGTGAGCATGATCTTCTTAATCAGAAGTGACAGCAAGCTTCACACACCCATGTAC
TTCTTCCTCAGCCATCTCTCCTTTGTAGATCTCTGTTATGCCACCAATGTTACTCCTCAG
ATGTTGGTTAATTTTTTATCAAAGAGAAAAACTATTTCCTTCATAGGCTGCTTCATACAG
TTCCACTTTTTTATTTCCCTGGTGATCACAGATTACTATATGCTTACAGTGATGGCTTAC
GATCGCTACATGGCCATCTGCAAACCTTTGTTATATACGAGCAAAATGTCCAGAAGCGTC
TGCCGCTCTCTTGTAGCTGCACCATACATTTATGGATTTGCAAATGGCCTGGCACAGACC
ATCCTGATGCTTCGTTTAACGTTTTGTGGACCCAATGAGATCAATCATTTCTACTGTGCA
GACCCACCACTCATGGTCCTTGCTTGCTCAGATACTTATGTTAAAGAAACTGCCATGTTT
GTGGTGGCAGGATCCAACCTCAGCTGTTCTCTCATCATCATCCTCATCTCCTACATTTTC
ATCTTTACAGCTATCCTGAGAATCCGTTCAGCAGAGGGGAGGCGCAAGGCCTTCTCTACT
TGTGGGTCCCATCTGGCAGCTGTCACTGTTTTTTATGGGACTTTGTTTTGTATGTACCTC
AGGCCTCCTTCTGAGAAGTCTGTAGAACAGGGGAAAATTGTGGCTGTCTTTTATATCTTT
GTAAGCCCAATGTTGAACCCCTTGATCTATAGCCTCAGAAACAAAGATGTGAAAAGGGCT
ATAAGGAAAGTTGTTAAGAAGGAAGTGTTCTTGAAG


Conceptual translation

MLKKNYTAVTEFILLGLTDRAELQPVLFLVFLLIYLITVTGNVSMIFLIRSDSKLHTPMY
FFLSHLSFVDLCYATNVTPQMLVNFLSKRKTISFIGCFIQFHFFISLVITDYYMLTVMAY
DRYMAICKPLLYTSKMSRSVCRSLVAAPYIYGFANGLAQTILMLRLTFCGPNEINHFYCA
DPPLMVLACSDTYVKETAMFVVAGSNLSCSLIIILISYIFIFTAILRIRSAEGRRKAFST
CGSHLAAVTVFYGTLFCMYLRPPSEKSVEQGKIVAVFYIFVSPMLNPLIYSLRNKDVKRA
IRKVVKKEVFLK