Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5m13b Olfactory Receptor

Gene Symbol Or5m13b
Organism Mouse
Family 5
Subfamily m
Pseudo No
Location chr2:85923270-85924190 (+)
Aliases Olfr1026, RP23-384L16.13, MOR196-4, RP23-384L16.13, MOR196-4

Sequence information


Nucleotide sequence

ATGTTAAAGAAAAACTTTACAACAGTTACAGAGTTTATTTTCCTAGGATTGACAGATCGA
GCAGAGCTTCAGCCTGTGCTCTTTGTGGTATTCCTACTCATCTACCTCATCACAGTGACT
GGTAACGTGAGCATGATCTTCTTAATCAGAAGTGACAGCAAGCTTCACACACCCATGTAC
TTCTTCCTCAGCCATCTCTCCTTTGTAGATCTCTGTTATGCCACCACTGTTGCCCCTCAG
ATGTTGGTTAACTTTTTATCCAAGAGGAAAAACATTTCTTTTATTGGCTGCATCATTCAA
TTCCACTTTTTTATTGCCCTGGTGATCACAGACTACTATATGCTTGCAGTTATGGCTTAT
GATCGTTATGTGGCCATCTGCAAGCCCTTGTTATATACTAGTAAAATGTCCCGAAGAGTC
TGTCTCTCTCTTGTGGCCACACAGTACATTTACGGCTTTGTAAATGGTTTAATACAGACC
ATTCTGATGCTTCGTTTAACCTTTTGTGGACCCAATGAGATCAATCACTTCTACTGTGCA
GATCCACCACTCATGGTCCTTGCTTGCTCAGACACCTATGTGAAAAAAACTGCCATGTTT
GTGGTGGCAGGATCCAACCTCACCTGTTCTCTCACCATCATCCTCATCTCCTATATTTTC
ATCTTTACAGCCATTCTGCGGATCCGTTCTGCAGAGGGGAGGCAGAAGGCCTTCTCTACT
TGTGGATCCCACCTGACTGCTGTTACCATCTTTTATGGAACATTGTTCTGCATGCACCTG
AGGCCCCCCTCTGAGACATCTGTAGAACAAGGGAAAATTGTGGCTGTCTTTTATATCTTT
GTAAGTCCTATGTTAAACCCATTCATCTATAGTCTGAGGAATAAAGATGTGAAAAATGCA
ATAAGGAAAGTGATCCAGAAA


Conceptual translation

MLKKNFTTVTEFIFLGLTDRAELQPVLFVVFLLIYLITVTGNVSMIFLIRSDSKLHTPMY
FFLSHLSFVDLCYATTVAPQMLVNFLSKRKNISFIGCIIQFHFFIALVITDYYMLAVMAY
DRYVAICKPLLYTSKMSRRVCLSLVATQYIYGFVNGLIQTILMLRLTFCGPNEINHFYCA
DPPLMVLACSDTYVKKTAMFVVAGSNLTCSLTIILISYIFIFTAILRIRSAEGRQKAFST
CGSHLTAVTIFYGTLFCMHLRPPSETSVEQGKIVAVFYIFVSPMLNPFIYSLRNKDVKNA
IRKVIQK