Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5m3 Olfactory Receptor

Gene Symbol Or5m3
Organism Mouse
Family 5
Subfamily m
Pseudo No
Location chr2:86,007,800-86,008,700 (+)
Aliases Olfr1032

Sequence information


Nucleotide sequence

MLNFTDVTEFILLGLTSRKELQVLFFVIFLMVYIVTMVGNIGMMILIKISPQLSSPMYFF
LSHLSFVDVWFSSNVTPKMLENLLSKTKTISYAGCLVQCFFFIALVHVEIFILAVMAFDR
YMAIGKPLLYGSKMSRVVCIRLISFPYIYGFLTSLAATLWTYGLYFCGKTEINHFYCADP
PLIKMACAGTFVKEYTMIILAGINFTYSLSVVIISYLFILIAILRMRSAEGRRKAFSTCG
SHLTAVVIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMD
KVISRKGLTK


Conceptual translation

MLNFTDVTEFILLGLTSRKELQVLFFVIFLMVYIVTMVGNIGMMILIKISPQLSSPMYFF
LSHLSFVDVWFSSNVTPKMLENLLSKTKTISYAGCLVQCFFFIALVHVEIFILAVMAFDR
YMAIGKPLLYGSKMSRVVCIRLISFPYIYGFLTSLAATLWTYGLYFCGKTEINHFYCADP
PLIKMACAGTFVKEYTMIILAGINFTYSLSVVIISYLFILIAILRMRSAEGRRKAFSTCG
SHLTAVVIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMD
KVISRKGLTK