Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5m3b Olfactory Receptor

Gene Symbol Or5m3b
Organism Mouse
Family 5
Subfamily m
Pseudo No
Location chr2:86041317-86042246 (+)
Aliases Olfr1033, RP23-298M2.5, MOR199-2, RP23-298M2.5, MOR199-2

Sequence information


Nucleotide sequence

ATGCTCAATTTCACAGATGTGACTGAATTTGTCCTTTTGGGATTAACCAGAAGAAAAGAA
CTGCAAGTTCTCTTCTTTGTCATCTTTCTCATGGTCTACATAGTTACCATGGTGGGCAAC
ATTGGCATGATGATATTAATTAAGATCAGTCCACAGCTCAGTAGCCCAATGTACTTTTTC
TTGAGCCATTTGTCATTTATTGATGTGTGGTTTTCTTCCAATGTCACTCCTAAAATGCTG
GAAAACTTGCTGTCAAAGACAAAAACAATTTCTTATGCTGGCTGCTTAGTACAGTGCTTC
TTCTTCATTGCCCTTGTTCATGTGGAAATCTTCATTCTTTCTGTGATGGCTTTTGACAGG
TACATGGCAATTGGAAAGCCTCTGCTCTATGGCAGCAAAATGTCCAGGGTGGTTTGCATT
CGACTCATTTCTTTCCCCTACATATATGGGTTTCTGACTAGTCTGGCTGCAACCTTATGG
ACTTATGGCTTGTACTTCTGTGGGAAAACTGAGATCAATCACTTCTACTGTGCAGATCCA
CCCCTCATCAAGATGGCCTGTGCAGGGACCTTTGTGAAAGAATATACAATGCTATTTCTT
GCAGGCATTAACTTCACATATTCCTTGATTGTTGTCATCATCTCCTACCTGTTCATTCTC
ATTGCCATTCTCAGAATGCGCTCAGCAGAAGGCAGGCGCAAGGCATTTTCCACCTGTGGA
TCTCACCTTACAGCAGTTGGCATATTTTATGGCACTCTCATCTTCATGTACCTCAGACGA
CCCACTGAGGAGTCAGTGGAGCAAGGGAAGATGGTGGCTGTGTTCTATACCACAGTGATC
CCCATGTTGAATCCCATGATCTACAGTCTGAGGAACAAGGATGTCAAGGAAGCCATGGAC
AAAGTGATTGCCAAGAAGTTCTTAACAAAA


Conceptual translation

MLNFTDVTEFVLLGLTRRKELQVLFFVIFLMVYIVTMVGNIGMMILIKISPQLSSPMYFF
LSHLSFIDVWFSSNVTPKMLENLLSKTKTISYAGCLVQCFFFIALVHVEIFILSVMAFDR
YMAIGKPLLYGSKMSRVVCIRLISFPYIYGFLTSLAATLWTYGLYFCGKTEINHFYCADP
PLIKMACAGTFVKEYTMLFLAGINFTYSLIVVIISYLFILIAILRMRSAEGRRKAFSTCG
SHLTAVGIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMD
KVIAKKFLTK