Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5m8 Olfactory Receptor

Gene Symbol Or5m8
Organism Mouse
Family 5
Subfamily m
Pseudo No
Location chr2:85991819-85992826 (+)
Aliases Olfr1031, RP23-298M2.3, MOR200-1, RP23-298M2.3, MOR200-1

Sequence information


Nucleotide sequence

ATGACGAGAAACTTCACCTCTGTGACTGAATTCATCCTCCTGGGTCTCACTAGCCATGTG
GAGCTTCAAATTCTCTTTTTTGTGTTGTTTCTAGTGGTATATGTGGTCACAGTTGCAGGC
AACCTGGGCATGATCCTGCTCATCAAGGCCAATGCCAGGCTCCACACACCCATGTACTTT
TTCTTGAGCCACTTATCCTTTGTGGATATGTGCTTCTCTTCCAATGTGACCCCAAAGATG
CTCCAGATTTTCCTGTCAGAGAGGAAAACTATTTCCTACTCTGCATGCTTGGTCCAATGT
TACCTCTTCATTGCATTGGTCCATGTTGAATTCTACATCCTGGCTCTGATGGCCTTTGAT
CGTTACATGGCCATCTGCAACCCTCTGCTTTATGGTAGCAAGATGTCCCAGAGTGTATGC
ACATCTCTAATCACAGTGCCTTATGTGTATGGGGCACTTACTGGTCTGATGGAGACCATG
TGGACTTACAACCTGGCTTTCTGTGGCCACAATGAAATCAATCACTTCTATTGTGCTGAT
CCACCATTGATTAAGCTGGCTTGTTCTGACACTTATCACAAAGAAACCTCCATGCTTGTT
GTAGCTGGATTTAACCTCTCCTTCTCCCTGCTCATTATTCTCACTTCCTACCTGTATATC
TTTCCTGCTATTCTGAGGATTAGCTCTACAGAAGGCAAGCGGAAAGCTTTCTCCACCTGT
GGCTCCCATCTGACAGCTGTCATCATATTCTATGCAACTCTTTTTTTCATGTATCTCAGA
CCAACATCTAGAGAGTCTGTGGAACAAGGTAAAATGGTTGCTGTGTTCTATACCACTGTC
ATTCCCATGTTGAACCCCATGATTTACAGCCTGAGGAACAAAGATGTGAAAGAAGCAATA
AGCAAGGAACTGTCACACAAAAAAATGTATTTTTCTGAAAAAAGGAATTCAATTTTCTTT
TGCACTCGTGGAACTTTTTGTAGGAATTATCATTGTTTTCTAAAGTTG


Conceptual translation

MTRNFTSVTEFILLGLTSHVELQILFFVLFLVVYVVTVAGNLGMILLIKANARLHTPMYF
FLSHLSFVDMCFSSNVTPKMLQIFLSERKTISYSACLVQCYLFIALVHVEFYILALMAFD
RYMAICNPLLYGSKMSQSVCTSLITVPYVYGALTGLMETMWTYNLAFCGHNEINHFYCAD
PPLIKLACSDTYHKETSMLVVAGFNLSFSLLIILTSYLYIFPAILRISSTEGKRKAFSTC
GSHLTAVIIFYATLFFMYLRPTSRESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAI
SKELSHKKMYFSEKRNSIFFCTRGTFCRNYHCFLKL