Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5m9 Olfactory Receptor

Gene Symbol Or5m9
Organism Rat
Family 5
Subfamily m
Pseudo No
Location chr3:73390268-73391197 (+)
Aliases Olr475, Olr475

Sequence information


Nucleotide sequence

ATGCCAAATTTTACAGATGTAACCGAATTTCTTCTTGTTGGATTGACAAGACGTCAGGAA
TTGCGGGTTCTCCTTTTTGCGGTGTTCTTGGTTGTTTACATGGTCACTCTATTGGGCAAC
ATTGGTATGATAATTTTAATCAGCATAAGCCCACAGCTTCAGAGTCCTATGTATTTTTTT
CTAAGTCATTTGTCCTTTGTGGATGTGTTGTTCTCCTCGAATGTTACCCCCAAAATGTTG
GAAAATTTACTTTCAGAAAGAAAAACTATTTCTTATGTCGGGTGTCTGGTACAATGCTAC
TTTTTCATTGCTCTGGTGCACGTGGAGGTCTACATTCTAGCAGTGATGGCCTTTGATCGC
TACATGGCCATTTGTAACCCTCTGCTCTACAGCAGCAAGATGTCCACGGTTGTCTGTGTC
CGCCTAATTTCTGTGCCTTATGTCTATGGATTCTCTGTGAGTCTGATTTGCACTCTGTGG
ACCTACGGTTTATATTTCTGTGGAAATGTTAAAATCAACCACTTCTATTGTGCTGATCCT
CCTCTCATCAAGATTGCCTGCGGAGGAGTGCATATCAAAGAGTACACAATGATAGTTATT
GCCGGAATTAATTTCACATATTCCTTGTCGGTGGTTCTCATTTCATACATGCTCATTGTA
GTAGCAGTGTTACGCATGCACTCGGCTGATGGCAGGAGAAAGGCATTCTCCACCTGTGGA
TCCCACTTAACAGCCGTTTCCATGTTTTACGGGACCCTTATATTCATGTATCTCAGAAGG
CCAACAGAGGAGTCGGTGGAACAGGGAAAGATGGTGGCTGTATTTTATACCAGTGTGATT
CCTATGCTGAACCCCATGATCTACAGTCTCAGGAACAAAGATGTGAAGGAAGCAGTCAGC
AAGATAATTGCCAAGGCAAACTTGAGGAAA


Conceptual translation

MPNFTDVTEFLLVGLTRRQELRVLLFAVFLVVYMVTLLGNIGMIILISISPQLQSPMYFF
LSHLSFVDVLFSSNVTPKMLENLLSERKTISYVGCLVQCYFFIALVHVEVYILAVMAFDR
YMAICNPLLYSSKMSTVVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNVKINHFYCADP
PLIKIACGGVHIKEYTMIVIAGINFTYSLSVVLISYMLIVVAVLRMHSADGRRKAFSTCG
SHLTAVSMFYGTLIFMYLRRPTEESVEQGKMVAVFYTSVIPMLNPMIYSLRNKDVKEAVS
KIIAKANLRK