Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5n1-ps Olfactory Receptor

Gene Symbol Or5n1-ps
Organism Mouse
Family 5
Subfamily n
Pseudo Yes
Location chr2:86704917-86705736 (-)
Aliases Olfr1088-ps1

Sequence information


Nucleotide sequence

ACCAAAGTCACTGAATTTGTGCTGAAAGGTCTCATGCACCATGATCACCTACGAGTTCTT
TTTCCTTTTGCAATTTACATTTTTACTCTCATGGGAAATTCGGATTGGACTGATTGATCT
GATCGTTGGATATTCCTGGCTGCACAACTTACATAATATTTTTGAATGCATTGCCCTAAG
CAGATGCCTCCATTTTCTTTTGCTATCATTCCCCAATTGTTAGTAAGTTCTTGTCAGAGA
GGAAAGGCATTTCATTTCTTAGCTGTGTTGCACAGATACTTCCTGCTGTTATGTTTGGAA
ACATAGAATGTTTTCTGTTGACCACCATGATTTATGACTACTATGGGTCCATGTACAACC
CACTGCTATATGTATTTAGCCACCAAGAGTCTATTTGACACTAATCACTTCTTGTTATAA
AGGAGAAGGCTTGCATGTTCTTATTCACACTGTGACCATTTTTAGCAATCCCTTCTGTGG
GTCCAATGAAATCATTCATGTTTTCCATGACATCCCTGCTCACCTGGCATTTTTTGTTCT
TACAGTTTCTTCTATCAGCTTCTTCTCTTATGTTGTTCTGTGTTTATTGAGACAGTCATA
ATCCTAATTGTCCTATGTTTGTATGGCTTCATTCTATCTACTATCTAGAGGATATGCTCT
GCTGAAGATAAAAGAAAAGTCTTCTCTACTTGTTGCTTTCATACAACTGCAGTTTCCATT
TTTCATGTATATAAGACCAATTTCCAACTATACCTTTGAGTGGGACATTGTAGAATTAAT
ATTTTACACCATTGTGATTCACATGCTAGATCCTCTTTTA


Conceptual translation

TKVTEFVLKGLMHHDHLRVLFPFAIYIFTLMGN/GLD*LI*SLDIPGCTTYIIFLNALP
*ADAS\SFAIIPQLLV/FLSERKGISFLSCVAQILPAVMFGNIECFLLTTMIYDYYGS
MYNPLLYVFSHQE/YLTLITSCYKGEGLHVLIHTVTIFSNPFCGSNEIIHVFHDIPAHL
AF/CSYSFFYQLLLLCCSVFIETVIILIVLCLYGFILSTI*RICSAEDKRKVFSTCCFH
TTAVSIF\YIRPISNYTFEWDIVELIFYTIVIHMLDPLL