Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5n2-ps Olfactory Receptor

Gene Symbol Or5n2-ps
Organism Rat
Family 5
Subfamily n
Pseudo Yes
Location chr3:73912324-73913413 (-)
Aliases Olr512-ps, Olr512-ps

Sequence information


Nucleotide sequence

TTAGCATAGATATAGATTATGTTCTTTAGACTTGTTGAATTCTTCTTCTTTTACAGTATC
ACAGAGCTGTAATTTATGTTTATATTCAACAACTTTAAGAGTTAAATGTACATTTAACAC
CAAAATCACTGAATTTGTATTGAAAGACCTCATACACAACGATAACCTACAAGTTACCTT
TTACTTTTATCTAACAATTTACATTTTTACTCTCATGGAGAGTTTAGATTGGACTGATTG
ATCTGGTTATTGGTTATTCCTGGCTACACAACTTGCATATTAATTTTGAATGTGCTGTCT
TCATTAGCACCTTCATTTTTCTTTGCAGTCACTCCACAATTGTCAATAGGTTCTGTGTCA
GAAAGGAAAGGCATTTCATTCCTCAGTTGTGTTGTACAGATATTTCCTGCTGTTACTTTT
GGAAACACAGCATGGTTTCTGTAGACCATGATGGCTAAGAACATTATTGTGTCATGTACA
ACCCACTACTATATGTATTTAGCCATCATGAGTCTATTTGCCACTAACCATTGCTTGCTA
TGCAACAGAAGGTTTGAATGCTATTATTCATACTGTGGCTACTTTCAGCATTTCCTTCTT
GGATACAAAGAAATCATTCTTATTTTGCACAACATCCCTGCTTAGTTGGCATGTTTTTGT
TCTTACAGGCTCTTCAATCAGCTTTTTCTCTTCTATTACTTTCTGTCTATTGAGACAGTC
ACCATCTTGATTGTCTTACTGGTGTATGGCATCATTCTATCTGCTATCCTGAGGACATGC
TCTGCTGAAGGTAAAAGAAAAGTCTTTGCTACATGTGGCTTTCATATAACCGCAGTTTCC
ATTTTTCACAACACTGTTGTGTTCATGTATATAAGACTAATTTCCAACTATACCTTGGAG
TAGGACATTGTATTATTAATATTTTATACTATTATGTTTCATATGCTGGATCCTGTCTTT
TTTTATAGTTTGAGTAAGAACAATGTATAACAAGCAATGAGAAAATGTATGAAATTTCTC
TTATTGATAATTCATATTTTAACTTTAAATATTACAGTCCAAAATTTTAGTCGTGTTTTC
TTTGTTGATA


Conceptual translation

TKITEFVLKDLIHNDNLQVTFYFYLTIYIFTLMESL/LD*LIWLLVIPGYTTCILILNV
LSSLAPSFFFAVTPQLSIGSVSERKGISFLSCVVQIFPAVTFGNTAWFL*TMMA/EHYC
VMYNPLLYVFSHHESIC/LTIACYATEGLNAIIHTVATFSISFLDT/EIILILHNIPA
*LACFCSYRLFNQLFLFYYFLSIETVTILIVLLVYGIILSAILRTCSAEGKRKVFATCGF
HITAVSIFHNTVVFMYIRLISNYTLE*DIVLLIFYTIMFHMLDPVFFYSLSKNNV*QAMR
KCMKFLLLIIHILTLNITVQNFS