Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5o1 Olfactory Receptor

Gene Symbol Or5o1
Organism Mouse
Family 5
Subfamily o
Pseudo No
Location chrX:49,727,000-49,728,200 (-)
Aliases Olfr1321

Sequence information


Nucleotide sequence

MLSPITKNCLPQAISQISLSSFWSLLHYYFIIKRKKEGTRCCWANLPSTPYTEWPLAGRR
QGFLYYTGYMVVLLLSSMFALLPVVYISSPQIMSPNLIDMGNLTAIKEFLLLGFGSLHGL
QFFLFGMFLGIYIMTLMGNILILTVTSSDHSLQTPMYFFLSNFSFLEIWYTTSIAPKMLK
TLLSGPEAISFTGCVAQFYFFGSMAVVECFLLASMSYDRYLAICSPLRYPSLMNFHTCFL
LAGGSWVGGFLTPVVTVTMTFQLQFCASNEIDHFFCDLAPVLKLACSDPTEVKRTTFLMA
SFVTMGPFLLTVASYINIVVAVFRMPSAAGKQRAFSTCSSHLIVVSLYYGTLGTVYAIPT
ATQATALNKVFSLLYTVVTPMVNPIVYSLRNKDVKKAVQKLLSKWKHPMKT


Conceptual translation

MLSPITKNCLPQAISQISLSSFWSLLHYYFIIKRKKEGTRCCWANLPSTPYTEWPLAGRR
QGFLYYTGYMVVLLLSSMFALLPVVYISSPQIMSPNLIDMGNLTAIKEFLLLGFGSLHGL
QFFLFGMFLGIYIMTLMGNILILTVTSSDHSLQTPMYFFLSNFSFLEIWYTTSIAPKMLK
TLLSGPEAISFTGCVAQFYFFGSMAVVECFLLASMSYDRYLAICSPLRYPSLMNFHTCFL
LAGGSWVGGFLTPVVTVTMTFQLQFCASNEIDHFFCDLAPVLKLACSDPTEVKRTTFLMA
SFVTMGPFLLTVASYINIVVAVFRMPSAAGKQRAFSTCSSHLIVVSLYYGTLGTVYAIPT
ATQATALNKVFSLLYTVVTPMVNPIVYSLRNKDVKKAVQKLLSKWKHPMKT