Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p50 Olfactory Receptor

Gene Symbol Or5p50
Organism Mouse
Family 5
Subfamily p
Pseudo No
Location chr7:107822526-107823467 (-)
Aliases Olfr469, MOR204-21

Sequence information


Nucleotide sequence

ATGGCTTTCCTGGAGGATGCGAACCACACTGCAGTGACAGAGTTCATTTTATTGGGTTTA
ACAGATGACCCAGTCCTTAAAGTTGTCCTCTTCAGCATCATCCTGTGCATCTACCTGGTG
ACTGTGTCTGGGAACCTCAGCACCATCCTTCTCATCAGAGTCTCTTCCCAGCTCCATCAC
CCCATGTACTTTTTTCTCAGCCACTTGGCTTCTGTTGACGTAGGCTACTCATCTACTGTC
ACACCCAAAATGCTTGCCAACTTCCTGGTGGAGAGAAGCACAATCTCCTACCTTGGGTGT
ACCATCCAGCTTTTCTCAGGTGCTTTTTTTGGGACACTTGAGTGCTTCCTTCTGGCCACC
ATGGCTTATGATCGTTTTATAGCAATCTGCAACCCATTGCTTTATTCCACCAAAATGTCC
ACACAAGTCTGTATCCAGTTGCTTGTAGGATCTTATATTGGTGGGTTTCTTAATGCTTCC
TCCTTTCTCCTTTCCTTCTTTCCTCTTCTCTTCTGTGGACCAAATAGAGTCAATCACTTT
TTCTGTGATTTGGCTCCTTTGATAGAGCTCTCCTGTTCAGGTAGCAATGTCCCCATAGTT
CCTGCCTCATTTTGTTCTGCCTTTGTCATTATAGTCACAGTATTTGTTATAGCCATCTCC
TACACCTACATCCTCATCACCATCCTGAAGATGCGCTCCACTGAGGGCCGACAGAAGGCC
TTCTCCACCTGCACTTCCCACCTCACTGCAGTCACTCTGTTCTATGGGACCATAACATTC
ATTTATGTGATGCCCAAATCAAGCTTCTCCACTGACCAGAACAAGGTGGTGTCTGTGTTC
TACATGGTTGTGATCCCCATGTTGAACCCCCTCATCTACAGCCTCAGAAACAATGAGATT
AAGGGTGCTCTGAAGAGACAGCTTGCTAGGAAAATATTCTCT


Conceptual translation

MAFLEDANHTAVTEFILLGLTDDPVLKVVLFSIILCIYLVTVSGNLSTILLIRVSSQLHH
PMYFFLSHLASVDVGYSSTVTPKMLANFLVERSTISYLGCTIQLFSGAFFGTLECFLLAT
MAYDRFIAICNPLLYSTKMSTQVCIQLLVGSYIGGFLNASSFLLSFFPLLFCGPNRVNHF
FCDLAPLIELSCSGSNVPIVPASFCSAFVIIVTVFVIAISYTYILITILKMRSTEGRQKA
FSTCTSHLTAVTLFYGTITFIYVMPKSSFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI
KGALKRQLARKIFS