Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p57 Olfactory Receptor

Gene Symbol Or5p57
Organism Mouse
Family 5
Subfamily p
Pseudo No
Location chr7:108065771-108066796 (-)
Aliases Olfr480, MOR204-32, Ors25, S25

Sequence information


Nucleotide sequence

ATGTTTTGTCATTTATATAATGAGAACAATATGCAAGTGGCAATCCTGGATTCCATTCTA
ATACCTTCTTATTTTTCTTTCCTGACAGAGATGGAGCCTGGAAACTACACAGTTGTAACA
GAATTCATTCTTTTAGGGTTAACAGATGATATTACAGTCAGTGTCATTTTATTTGTTATG
TTTCTAATCGTCTATTCTGTTACTTTAATGGGTAACTTGAACATAATTGTGCTAATCAGA
ACCAGCCCTCAGCTTCACACCCCCATGTACCTTTTCCTTAGCCATTTGGCCTTTCTAGAC
ATTGGGTACTCCAGCTCAGTTACACCCATCATGCTGAGGGGCTTTCTCAGAAAGGGAACA
TTTATCCCTGTGGCTGGCTGTGTGGCTCAACTCTGTATTGTGGTGGCATTTGGGACATCT
GAATCTTTCTTGCTAGCTTCCATGGCCTATGACCGCTATGTGGCCATCTGCTCACCTTTG
CTCTACTCAACACAGATGTCCTCCACAGTCTGCATCCTCCTAGTTGGAACTTCCTACCTA
GGTGGATGGGTGAATGCTTGGATATTTACTGGTTGCTCCTTAAATCTGTCATTTTGTGGG
CCAAATAAAATTAATCACTTTTTCTGTGACTATTCACCACTATTGAAGCTTTCTTGTTCT
CATGACTTTTCTTTTGAAGTCATTCCAGCAATCTCTTCGGGATCCATCATTGTGGTCACT
GTGTTTATCATTGCTCTGTCTTATGTCTACATCCTTGTGTCAATCCTGAAGATGCGCTCT
ACTGAAGGTCGCCAGAAGGCCTTCTCCACCTGCACTTCCCACCTCACTGCAGTCACTCTG
TTCTTTGGGACCATCACATTCATTTATGTGATGCCCCAGTCCAGCTACTCCACAGACCAG
AACAAAGTGGTGTCTGTGTTTTACACAGTGGTGATCCCCATGTTGAATCCCCTCATCTAC
AGTTTCAGAAACAAAGAGGTTAAAGAAGCCATGAAAAAACTGATTGCTAAAACACATTGG
TGGTCC


Conceptual translation

MFCHLYNENNMQVAILDSILIPSYFSFLTEMEPGNYTVVTEFILLGLTDDITVSVILFVM
FLIVYSVTLMGNLNIIVLIRTSPQLHTPMYLFLSHLAFLDIGYSSSVTPIMLRGFLRKGT
FIPVAGCVAQLCIVVAFGTSESFLLASMAYDRYVAICSPLLYSTQMSSTVCILLVGTSYL
GGWVNAWIFTGCSLNLSFCGPNKINHFFCDYSPLLKLSCSHDFSFEVIPAISSGSIIVVT
VFIIALSYVYILVSILKMRSTEGRQKAFSTCTSHLTAVTLFFGTITFIYVMPQSSYSTDQ
NKVVSVFYTVVIPMLNPLIYSFRNKEVKEAMKKLIAKTHWWS