Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p59 Olfactory Receptor

Gene Symbol Or5p59
Organism Mouse
Family 5
Subfamily p
Pseudo No
Location chr7:108103311-108104255 (+)
Aliases Olfr483, MOR204-12

Sequence information


Nucleotide sequence

ATGGCTTTCCTGCAGGATGGGAACCACACTGCAGTGACAGAGTTCATTTTATTGGGATTA
ACAGATGACCCAGTCCTCAGAGTTGTCCTCTTCACCATCATCTTGTGCATCTATCTGGTG
ACTGTGTTTGGCAACCTCAGCACCATCCTTCTCATCAGAGTCTCTTCCCAACTCCATCAC
CCCATGTACTTTTTTCTCAGCCACTTGGCTTCTGTTGACATAGGCATTTCATCTTCTGTC
ACACCCAGTATGCTTGTCAACTTCCTGTTGGAGAGAAGCACAATCTCCTACCTTGGATGT
GGCATCCAGCTTGGCTCAGCTGATTTCATTGCATCCGTTGAATGCTTCCTTTTGGCTGCC
ATGGCTTATGATCGCTTCATGGCAGTCTGCAACCCGCTGCTTTATTCCACCAAAATGTCC
ACACAAGTCTGTGTCCAGCTGGTTGTGGGATCTTATATAGGGGGTTTCCTTAATGCTTCC
CTCATCGTCACAGTTTACTTTTTCTCTTTTCTCTTCTGTGGGCCAAATAGAATCGATCAT
TTTTTCTGTGATTTTGCTCCTTTAGCAGAACTCTCCTGCTCTGATGTCAGTGTCTCTGTA
CTTATTATCTCATTTTCGGCTGGCTCAGTTACTATGATTACAGTGTTTGTCATAGTCATT
TCCTATTCCTACATCCTCATCACCATCCTGAAGATGCACTCCACTGAGGGCCGACATAAG
GCCTTCTCCACCTGCACCTCCCACCTCACTGCAGTCACTCTTTATTATGGCACCATTACA
TTCATTTATGTGATGCCCAAGTCCAGCTTCTCCACAGACCAGAACAAGGTGGTGTCTGTG
TTCTACATGGTGATGATCCCCATGTTGAATCCCCTCATCTACAGCCTCAGCAATAATGAA
ATTAAAGGTGCTCTGAAGAGACAGCTTGGTATGAAAACACTTTCT


Conceptual translation

MAFLQDGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVFGNLSTILLIRVSSQLHH
PMYFFLSHLASVDIGISSSVTPSMLVNFLLERSTISYLGCGIQLGSADFIASVECFLLAA
MAYDRFMAVCNPLLYSTKMSTQVCVQLVVGSYIGGFLNASLIVTVYFFSFLFCGPNRIDH
FFCDFAPLAELSCSDVSVSVLIISFSAGSVTMITVFVIVISYSYILITILKMHSTEGRHK
AFSTCTSHLTAVTLYYGTITFIYVMPKSSFSTDQNKVVSVFYMVMIPMLNPLIYSLSNNE
IKGALKRQLGMKTLS