Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p60 Olfactory Receptor

Gene Symbol Or5p60
Organism Mouse
Family 5
Subfamily p
Pseudo No
Location chr7:108124299-108125261 (-)
Aliases Olfr484, MOR204-16

Sequence information


Nucleotide sequence

ATGGCTTTCCTGCACAATGGGAACCACACTGCAGTGACAGAGTTCATTTTATTGGGACTA
ACAGATGACCCAGTCCTTAGAATTGTCCTCTTCACCATCATCCTGTGCATCTACCTGGTT
ACTGTGTCTGGGAACCTCAGCACCATCCTTCTCATCAGAGTCTCTTCCCAGCTCCATCAC
CCCATGTACTTTTTTCTCAGCCACTTGGCTTCTGCTGACATAGGCTACTCATCTTCTGTC
ACACCCAATATGCTTGTCAACTTCCTTGTAAAGCAAAATACCATCTCCTACATTGGATGT
TCTATACAATTTGGCTCAGCTGCTTTCTTTGGAGGACTTGAATGCTTCCTTCTGGCTGTC
ATGGCTTATGATCGCTTTGTAGCGATCTGCAACCCACTGCTCTATTCAACTAAAATGTCC
ACACAAGTCTGTGTCCAGTTGGTTGTAGGATCTTATATAGGAGGTTTTCTTAATGCCTCC
TTTGCCACAGTTTCTTTTTTATTCTTGTTCTTCTGTGGACCAAACATAATCAATCACTTT
TTCTGTGATTTTGCTCCTTTGATTGAGCTCTCCTGTTCTGATGTCAGGATCTCTGTACTT
GTTACCTCATTTTCTGCTGGCACAGTTACTATGCTAACAGTGTTGGTCATAGCCATTTCT
TACACCTATATCCTCATCACCATCCTGAAGATGCGCTCCACTGAGGGTCGACACAAAGCC
TTCTCCACCTGCACTTCCCATCTCACTGCAGTGTCTCTGTTCTATGGAACCATTACATTC
ATTTACGTGATGCCCAAGTCAAGATACTCCACAGACCAAAATAAGGTGGTGTCTGTGTTC
TATATGGTGGTAATCCCCATGTTGAACCCCCTCATCTACAGCCTCAGGAATAATGAGATT
AAGGGGGCTCTGAGGAGACATCTTGGTAAGAAAATATTTTCTCAGAGCAATATATTGTTT
TAT


Conceptual translation

MAFLHNGNHTAVTEFILLGLTDDPVLRIVLFTIILCIYLVTVSGNLSTILLIRVSSQLHH
PMYFFLSHLASADIGYSSSVTPNMLVNFLVKQNTISYIGCSIQFGSAAFFGGLECFLLAV
MAYDRFVAICNPLLYSTKMSTQVCVQLVVGSYIGGFLNASFATVSFLFLFFCGPNIINHF
FCDFAPLIELSCSDVRISVLVTSFSAGTVTMLTVLVIAISYTYILITILKMRSTEGRHKA
FSTCTSHLTAVSLFYGTITFIYVMPKSRYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEI
KGALRRHLGKKIFSQSNILFY