Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p62 Olfactory Receptor

Gene Symbol Or5p62
Organism Mouse
Family 5
Subfamily p
Pseudo No
Location chr7:108171801-108172742 (-)
Aliases Olfr486, MOR204-19

Sequence information


Nucleotide sequence

ATGGCTTTCATATACAACGGTAGCCAGACAACAGTGACAGAGTTCATATTATTGGGACTA
ACAGATGACCCAGTCCTTAAAGTCATACTCTTCTGCATCATCCTGTGCATCTACCTGGTG
ACTGTGTTTGGAAATCTCAGCACCATCCTTCTCATTGGAGTCTCTTCTAAGCTCCATCAC
CCCATGTACTTTTTTCTCAGCCACTTGGCTTCTGTTGATATGGGCCTTTCATCTTCTGTC
ACACCCAATATGCTTGTCAACTTCCTGACTGAGAAAAACACCATCTCCTACCTTGGATGT
GGCATACAGCTCAGCTCAGCTGCTTTCTTTGGGGCTGTTGAGTTCTTCCTTCTGGCTGCC
ATGGCTTATGATCGCTTGGTAGCAATCTGCAACCCACTGCTTTATTCCACCAAAATGTCC
TCACAAGTGTGTATCCAGTTGGTTGCAGGATCTTATGTAGGGGGTTTCCTTAACGCTTCA
TTTGTAACCCATTTCTTTTTTTCTTTTCTCTTCTGTGGCCCAAATAGGGTCAATCACTTT
TTCTGTGATTTATCTCCTATGATGGAACTATCCTGTTCTGATGTGAGTATCTCAGAAATT
GTTATCTCATTTTCTGCAGGCTCATTTACAATGACCACATTGTTTGTTATAGTCATACCT
TACTTCTATATCTTCATCACCATCTTGAAGATTCGTTCCACTGAGGGTCGCCAAAAAGCC
TTTTCCACCTGCACTTCCCATCTTACTGCAGTCACTCTCTACTATGGAACTATCATATTC
ATTTATGTGATGCCAAAGTCCACCTACTCCAGAGACCAGAACAAGGTGGTGTCTCTGTTC
TACATGCTGGTAATCCCCGTGTTGAATCCCCTCATCTACAGCCTTCGGAACAATGAGATT
AAGGATGCCCTGAAAAGACAATTTTATAGGAAAACATTGTTA


Conceptual translation

MAFIYNGSQTTVTEFILLGLTDDPVLKVILFCIILCIYLVTVFGNLSTILLIGVSSKLHH
PMYFFLSHLASVDMGLSSSVTPNMLVNFLTEKNTISYLGCGIQLSSAAFFGAVEFFLLAA
MAYDRLVAICNPLLYSTKMSSQVCIQLVAGSYVGGFLNASFVTHFFFSFLFCGPNRVNHF
FCDLSPMMELSCSDVSISEIVISFSAGSFTMTTLFVIVIPYFYIFITILKIRSTEGRQKA
FSTCTSHLTAVTLYYGTIIFIYVMPKSTYSRDQNKVVSLFYMLVIPVLNPLIYSLRNNEI
KDALKRQFYRKTLL