Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p70 Olfactory Receptor

Gene Symbol Or5p70
Organism Mouse
Family 5
Subfamily p
Pseudo No
Location chr7:108395122-108396111 (+)
Aliases Olfr495, MOR204-37

Sequence information


Nucleotide sequence

ATGGCTTTCCTAGAGGATGGGAACCATACTATAGTGACAGAGTTCATTTTATTGGGCTTA
ACTGATGACCCAGTTCTGAGAGACATCCTCTTCACCATCATCCTGTGCATCTATCTGGTG
ACCGTGTCCGGGAACCTCAGCACCATCCTTCTCATCAGAGTCTCTTCCCAGCTTCATCAC
CCCATGTATTTTTTTCTCAGCCACTTGGCTTCTGTTGACATAGGCATTTCTTCTTCTGTC
ACACCCAATATGCTTGCTAACTTCCTAGTAAAACCAAATACCATTTCCTACATTGGATGT
TCTATACAGTTTACCTCAGCTGTTTTCCTTGCGACAGTTGAGTGCTTCCTTCTGGCTGCC
ATGGCTTATGATCGCTTTGTAGCAATCTGCAACCCACTGCTTTATTCCACCAAAATGTCC
AGAGAAGCCTGTATCCAGTTGGTTGTAGGATCTTATATACAGGGTCTCCTTAATGCTTCC
TTTTTCACTCTTTCCTTCTTTTCCTTGATCTTCTGTGGACCAAATAGAATCAATCACTTT
TACTGTGATTTGGCTCCTTTGGTGGAACTCTCCTGTTCTGATGTCACTCTCGCTGTTGTT
ATTACCTCAATTTCTGCTGGCTTTATCACACTGACAACAGTGTTTGTTATAGCCATCTCC
TATTCCTGTATTTTCATCACTATTATGAAGATGCACTCCACAGAAAGTCGATACAAGGCC
TTCTCCACCTGTACCTCCCACCTCACTGCAGTTACTCTGTTCTATGGAACTACTATGTTC
ATTTATGTGATGCCCAAGTCCAGCTACTCCACTGACCAGAACAAGGTGTTGTCTGTATTC
TACATGGTTGTGATTCCCATGTTGAACCCCCTCATCTACAGCCTGAGGAATAATGAGATT
AAGGGGGCTCTGAAGAGATATCTTGGTAAGAAAATATTTTCTTATGGTAACCTGTTTTGT
AAAACTCACTATAATGACACTCACCAAGTA


Conceptual translation

MAFLEDGNHTIVTEFILLGLTDDPVLRDILFTIILCIYLVTVSGNLSTILLIRVSSQLHH
PMYFFLSHLASVDIGISSSVTPNMLANFLVKPNTISYIGCSIQFTSAVFLATVECFLLAA
MAYDRFVAICNPLLYSTKMSREACIQLVVGSYIQGLLNASFFTLSFFSLIFCGPNRINHF
YCDLAPLVELSCSDVTLAVVITSISAGFITLTTVFVIAISYSCIFITIMKMHSTESRYKA
FSTCTSHLTAVTLFYGTTMFIYVMPKSSYSTDQNKVLSVFYMVVIPMLNPLIYSLRNNEI
KGALKRYLGKKIFSYGNLFCKTHYNDTHQV