Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p71-ps Olfactory Receptor

Gene Symbol Or5p71-ps
Organism Mouse
Family 5
Subfamily p
Pseudo Yes
Location chr7:108417104-108418004 (+)
Aliases Olfr496-ps1, MOR204-28P

Sequence information


Nucleotide sequence

TTGGCTTTCCTAGAGGATGGGAACCACACTATAGTGACAGAGTTCACTTTACTGGACTTA
ACAGAAGACCTAGTCCTTAGAGTCATCCTCTTCAGCATCATCCTGTGCATCTACCTTGTG
TCTGTGTCTGGCAACCTCAGCACCATTCTTCTCATCACACGCTCTATCACACCATGTACT
TTTTTCTCAGCCACTTGGCTCTGTTGACATGGGCCTTTCATCTTCTGTCACACCCAATAT
GTTTGTCAACTTCCTGACTGAGAGACATACCATCTCCTACTTTGGATGTGGCATCCAGCT
CAGCTCAGCTGCTTTCTTTGGGGCAGTTGAATTCTTCCTTCTGGCTGTCATGACTTATGA
TTGCTTGATAGCGATCTGAAACCCACTGCTTTATTCCACCAAATTGTCCACACAAGTCTG
TATCTAGTTGGTTGTAGGATCTTATGTAGGCGGTTTCCTTAACGCTTCATTTGTGCCCAT
TTCTTTCTTTCTTTTCTTTTCTATGGACCTAATAGAGTCAATCACTTTTTCTGTGATTTT
CATCCTATGATGGAACTCTCCTGTTCTGATGTGAGTGTCTCTGGAATTGTTATCTCATTT
ACTGCTGGCTTAATCTCTATGACCACATTGATTGTTATAGTCATATCTTATTTCTATTCC
CTCATCACCATCCTGAAGATGCAATCCACTGAGGGTCACCAAAAAACCTTCTCCACCTGC
GCCGCCCACCTCACTGCAGTCATTCTCTCTTATGGAACAGCCACATTCTTTTATGTGATG
CCAAAGTCCACCTACTCTGAGGACCAGAACAAGGTGGTGTCAGTTCTACACAGTAGCAAT
CCCCGTGTGGAATCCCCTCATCTACAGCCCTTGGAATACTGAGACTAAGAATGCCCTGAA
A


Conceptual translation

LAFLEDGNHTIVTEFTLLDLTEDLVLRVILFSIILCIYLVSVSGNLSTILLIT/LYHTM
YFFLS/LGSVDMGLSSSVTPNMFVNFLTERHTISYFGCGIQLSSAAFFGAVEFFLLAVM
TYDCLIAI*NPLLYSTKLSTQVCI*LVVGSYVGGFLNA/ICAHFFLSFLFYGPNRVNHF
FCDFHPMMELSCSDVSVSGIVISFTAGLISMTTLIVIVISYFYSLITILKMQSTEGHQKT
FSTCAAHLTAVILSYGTATFFYVMPKSTYSEDQNKVVS\YTVAIPVWNPLIYSPWNTET
KNALK