Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p74-ps Olfactory Receptor

Gene Symbol Or5p74-ps
Organism Mouse
Family 5
Subfamily p
Pseudo Yes
Location chr7:108485906-108486857 (+)
Aliases Olfr500-ps1, MOR204-25P

Sequence information


Nucleotide sequence

CTAGCTTTCCTGGAGTATGGGGACCACACTACAGTGAAAGAGTGCATTTTACTGGGTTTA
ACAGATGACCCAGTCTTTAGAGTCATCCTCTTCAGCATCATCCTGTGCATTTACCTGGTG
ACTGTGTTTGGCAACCTCAGCACCATCCTTCTAATCAGAGTCTCTTCCCAGCTCCATCAC
CCCATGTACTTTTTTCTCAGCCACTTGGGTTCTCCTGACATAGGCTAAGCATCTTCTGTC
ACACCTATTATGCATGTCAATTTCCTGGTGGATAAAAATATCATTATGACCCTAGGGTGT
AATATCCACCTTGGCTCAGGTGCTTTCTTTGGGACAGTTGAGTGCTTTGTTCTAGCTGCC
ATGGCTTATGATTGCTTTGTGGCAATCTGTAGTTCACTGCTTTATTCAAACAAGATGTCC
TCACAAGTCTGTGTTCAGTTGCTTGTAGTAACATACGTAAGCAGTTTTCTTAATACTTCT
TGCTTCACCCTTTCTTTCTTTTCTTTTTACTTCTGTGGACCAAATAGAATCAAACTCTTT
TTCTGTGATTTTACTCCTTTAGTTGAGCTCTCTATCTTTTGACAGTGTTTCTATTCTTGT
TACTATTTCTGGTGGCACTGTCATTGTGATTACAGTGTTTATTATTGCTGTCTCATACAT
TTACATCTTCATCACCATTCTGAAGATGCACTCCACTGGGTGTCGCCATAAAGCCTTTTT
CACCTGCACCTCCCACCTCACTACAGTCACCCTGTTCTATGGAACTGTCACATTCATCTA
CCTGATGCCAAAATCTAGCTACTCCACAGACCAAAACAAGGTGGTGTCTGTGTTCTGCAT
AGTGGTGATCCCCATGTTGAATCCACTCATCTACAGCCTCAGAAATAATGAAATTACAGA
TGCTCTTAAGAGACATATAGGTAGGAAAACATGTTCTTGGAGAAATCTATTA


Conceptual translation

LAFLEYGDHTTVKECILLGLTDDPVFRVILFSIILCIYLVTVFGNLSTILLIRVSSQLHH
PMYFFLSHLGSPDIG*ASSVTPIMHVNFLVDKNIIMTLGCNIHLGSGAFFGTVECFVLAA
MAYDCFVAICSSLLYSNKMSSQVCVQLLVVTYVSSFLNTSCFTLSFFSFYFCGPNRIKLF
FCDFTPLVELSIF/TVFLFLLLFL/GTVIVITVFIIAVSYIYIFITILKMHSTGCRHK
AFFTCTSHLTTVTLFYGTVTFIYLMPKSSYSTDQNKVVSVFCIVVIPMLNPLIYSLRNNE
ITDALKRHIGRKTCSWRNLL