Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p75-ps Olfactory Receptor

Gene Symbol Or5p75-ps
Organism Mouse
Family 5
Subfamily p
Pseudo Yes
Location chr7:108508058-108509000 (+)
Aliases Olfr501-ps1, MOR204-27P

Sequence information


Nucleotide sequence

ATGGCTTTCCAGGCGGATGGAAACCACACTACAGTAACAGAGTTCCTTTTGTTAGGCTTA
ACAGATGATCCAGTGCTTAGAGTCATCCTCTTCACCATCATCCTGTGCATCTACCTGGTA
ACTGTGTCTGGGAACCTCAGCACCATCCTTCTCATCAGAGTCTCTTCCCAGCTCCATCAC
CCCATGTACTTTTTTTCTCAGCCACTTGGCTTCTGTAGACATAGGCATTTCATCTTCTGT
TACACCCAATATGCTTGTTAACTTCCTGGTGGAGAGAAATACCATCTCCTACCTTGGATG
GGGCATACAGCTCAGCTTTGGTGATATCTTTGGGTCAGTTGAATGTTTTCTTTTGGCTAC
CATGGCTTATGATCGCTTCATGGCAATCTGCAACCCACTGCTTTATTCCACCAAAATGTC
CACACAAGTCTGTGTCCAGTTGGTTGTGGGATCTTATATAGGAGGTCTTCTTAATGCTTC
CTTTGCTATGGTTTCCTTTTTTTCTTTTTTATTCTGTGGCTCAAATAGAGTTGAACATTT
TTTCTGTGATTTTGTTCCTTTAGCTGAGCTGTCCTGTTCTGATATCAGTATCTCCGTAGT
TCTTGTTTCATTTTCTGCTGGCTCAGTTACTATGCTAACAGTGTTTATCATAGTCATCTC
CTATTCTTACATCCTCATCACCATCCTAAAGATGCGTTCCACGGAGGGGCGACAGAAGGC
CTTCTCCACATGAACCTCCCATCTCACAGCAGTCACTCTGTTCTATGGGACAATCACATT
TATTTATGTGATGCCCAAGTCCAGCTTCTCTACTAACCAGAACAAGGTGGTGTCTGTGTT
CTACATGGTAGTCATCCCCATGTTGAATCCCCTCATCTACAGCCTCAGAAATAATGAGAT
TAAGGATGCTCTGAGGAGACATCTTGGTAAGAAAACACTTTCT


Conceptual translation

MAFQADGNHTTVTEFLLLGLTDDPVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHH
PMYFF\SHLASVDIGISSSVTPNMLVNFLVERNTISYLGWGIQLSFGDIFGSVECFLLA
TMAYDRFMAICNPLLYSTKMSTQVCVQLVVGSYIGGLLNASFAMVSFFSFLFCGSNRVEH
FFCDFVPLAELSCSDISISVVLVSFSAGSVTMLTVFIIVISYSYILITILKMRSTEGRQK
AFST*TSHLTAVTLFYGTITFIYVMPKSSFSTNQNKVVSVFYMVVIPMLNPLIYSLRNNE
IKDALRRHLGKKTLS