Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5p77-ps Olfactory Receptor

Gene Symbol Or5p77-ps
Organism Mouse
Family 5
Subfamily p
Pseudo Yes
Location chr7:108574560-108575385 (+)
Aliases Olfr505-ps1, MOR204-24P

Sequence information


Nucleotide sequence

GTTTGTGCAGGAATAGAAACCCTGACTAAGACACTTCTCATCAGAGTCTCTTCCCAGCTC
CATCACCCCATGTACTTTTTTCTAAGCAACTTAGCTTCTATAGACATAGCCTATTCATCT
TCTGTCACACCCAATATGCTTGCCAACTTCCTGGTAAAGCAAAATACCATCTCCTACATT
GGATGTTCTATTCAATTCGGCTCAACTGCTTTTTGGGGGACAGTTGAATGCTTTCTTCTG
GCTGTCATGGCTTATGATCGCTTTGTAGCAATCTGCAACCAACTGCTTTATTCCACAAAA
ATGTCTACAGAAGCCTGTATCCAGTTGGTTTTAGGATCTTATATAGGTGGCTTTCTTACT
GCTTTATCCTTCATCCTTTCCTTCTTTTTATTTATCTTCTGTGGTCCAAATAGGATCAAT
CATTTTTTCTGTGATTGCTCCTTTGGTGGAACTCTCCTGTTCCGATGTCAGTGTCTCTGT
ACTTGTTACCTCATTTTTTGTTGGTTTAGTCACTGTGATCACAGTGTTTGTCATAGCCAT
CTCCTATATCTACATCCTTATCACCATCCTGAAGATGCGCTCCACTGAGGGCAGTCACAG
GGCCTTCTCCACCTGCACCTCCCACCTCACTGCAGTCACTCTCTTCTATGGTACTGTCAC
ATTCATCTATGTGATCCCCAAGTCCAACTACTCCACTGATCAGAAGAAAGTGGTCTCTGT
GTTCTACACGGTGGTTATCCCCATGCTGAACCCCATTATCTATAGCCTTAGAAATAATCA
GATTAAGGGTGCTTTGAAAAGACTGCTTGGTAAGAAAATATTTTCT


Conceptual translation

YVCAGIETLTKTLLIRVSSQLHHPMYFFLSNLASIDIAYSSSVTPNMLANFLVKQNTISY
IGCSIQFGSTAFWGTVECFLLAVMAYDRFVAICNQLLYSTKMSTEACIQLVLGSYIGGFL
TALSFILSFFLFIFCGPNRINHFFCD//PLVELSCSDVSVSVLVTSFFVGLVTVITVF
VIAISYIYILITILKMRSTEGSHRAFSTCTSHLTAVTLFYGTVTFIYVIPKSNYSTDQKK
VVSVFYTVVIPMLNPIIYSLRNNQIKGALKRLLGKKIFS