Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5q1-ps Olfactory Receptor

Gene Symbol Or5q1-ps
Organism Mouse
Family 5
Subfamily q
Pseudo Yes
Location chr19:12340440-12341124 (-)
Aliases Olfr1439-ps1, MOR214-7P

Sequence information


Nucleotide sequence

GAAGAAAATACAACTGAGATAACCCAATTCATCTGTCTGGGGTTTTCAGATTCCCCAGAA
ATCACAGAACTATTATTTGACTTATCCACACCTGGAACATGTCCTTCATTGTTTTAATAA
GGATGGATTCACACCTCCACACACCTAGTATTTCCTTCAAAGAAATCTACTACATCAGCT
CAGCAATAGAATAATGCTTTCCAAATTCTTCCAAGAAAAGCAAACTATCAGCTTTGTGGG
CTACATGGTATAATATTTTATCTTTTTCACTAGGGTGCTAAGTGAATCTTTCCTTGTGAC
AGCTATGCCTATGACAAGTATGCTATCATTTGCAACCCCACTGCTCTATCACCAATCATG
TTACCCACCCTGTGTGCTTGGGTGATGGTAGAATCTTATGTGACTACAAACTCATCTTCT
TTACCTCAGATTTGTACCTTGTTGCAGCTCTACTTCTGTGGACTTAACATCAACAGATGT
TTCTTCTGTGACATGCCCCAGCTGTTAAATCTGTCCTACACTGACAAATTCTTTGTACAG
TTTCTGCTTGCCATATTTACAAGGTTGTTTAGAATAGTGAATGCCTTACTCATCTCAATA
GCATATGACTATGTAGCCATATCTGTAGTGTATAGTTTCTACTACGCCACTTTTAGCTTG
GGGTGGACCACAATACAAGGCCCAC


Conceptual translation

EENTTEITQFICLGFSDSPEITELLFDL/HTWNMSFIVLIRMDSHLHTP/YFLQRNLL
HQLSNRIMLSKFFQEKQTISFVGYMV*YFIFFTRVLSESFLVTA/AYDKYAIICNPTAL
SPIMLPTLCAWVMVESYVTTNSSSLPQICTLLQLYFCGLNINRCFFCDMPQLLNLSYTDK
FFVQFLLAIFTRLFRIVNALLISIAYDYVAISVVY\STTPLLAWGGPQYKAH