Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5q2-ps Olfactory Receptor

Gene Symbol Or5q2-ps
Organism Rat
Family 5
Subfamily q
Pseudo Yes
Location chr1:229,454,000-229,455,000 (+)
Aliases Olr333-ps

Sequence information


Conceptual translation

LICNWNTFLIVLIRMDSHLHTLVYFFF/D/SFKVLYYITSTITMTFSKFFQEKQTIHF
VNYKV*YFIFFTRGLSEYFLMTA/ACDKYAVICNLSPIISPTLCAWMVVGSYMTGLTTF
VSLICTLLQLYFSGLTSIN/FFCDMPQLLNLSCTDKFFVQLLLAILTTLFGIANALFIM
I\YVVLSVAYSFCCSALSYQASPGT/WMHAHISLIFY