Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5r1 Olfactory Receptor

Gene Symbol Or5r1
Organism Mouse
Family 5
Subfamily r
Pseudo No
Location chr2:86,121,900-86,122,800 (+)
Aliases Olfr1038

Sequence information


Nucleotide sequence

MAEVNISYVSEFILKGITDRPELQAPCFVMFLTIYLVTVLGNLGLIVIIRVDSRLHTPMY
FFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAY
DRYVAICSPLHYSTLMSKRVCIQLVAVPYVYSFLVALFHTIITFRLTYCGPNVINHFYCD
DLPLLALSCSDTHMKEILIFAFAGFDMICSSSIVLTSYLFIIAAILRIRSTQGRRKAIST
CGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTGDPHVEPPHLQS


Conceptual translation

MAEVNISYVSEFILKGITDRPELQAPCFVMFLTIYLVTVLGNLGLIVIIRVDSRLHTPMY
FFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAY
DRYVAICSPLHYSTLMSKRVCIQLVAVPYVYSFLVALFHTIITFRLTYCGPNVINHFYCD
DLPLLALSCSDTHMKEILIFAFAGFDMICSSSIVLTSYLFIIAAILRIRSTQGRRKAIST
CGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTGDPHVEPPHLQS