Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5t15-ps Olfactory Receptor

Gene Symbol Or5t15-ps
Organism Rat
Family 5
Subfamily t
Pseudo Yes
Location chr3:74318431-74319354 (+)
Aliases Olr524-ps, Olr524-ps, Olr520

Sequence information


Nucleotide sequence

ATGAAGAACATCACAGAAGCTACTTCGTTTGTTCTCAAGGGACTCACAGACAACAAAGAA
CTTCAGATCATTCTCTTTTTCCTATTTCTAGCAGTTTACCTTTTTACTCTAATAGGAAAT
ATAGGACTTATTTTTTTAGTTGTTGGAGATCCCCAGCTCCACAACCCTATGTACTGTTTC
CTCAGTGCATTGTCTTCTGTAGATGCCTGTTATTCTTCAGATATCACCCCAAATATGTTA
GTAGGTTTTGTGTCTAACAGTAAAATCATTTCATTTCATGGTTGTGCAACACAGATGTTC
TTTGCTGTTACATTTGGAACCACAGAATGCTTTCTTTTGGCAGCAATGGCATATGATCGA
TATGAAGCCATTCACAACCCACTTCTGTATGCAGTGAGCATGTCTCCTAAAGTCTATGTG
CCACTTATCGTTGCTTCCTATGCTGGTGGAATTCTGCATGCTATTATCCACACAGCGCCC
ACTTTCAGCCTGTTGTTCTGACAGTCCAATGAAATCAAACATATATTCTGTGATATACCT
CCTCTACTTGCTATTTCCTGTTCTGAAACTTATATAAATGAGTTCTTGCTCTTGCTCTTT
GTGAGTTTCATAGAGCTAGTCACCATCCTGATCATTCTGTTCTCCTATGCTTTTATCTTT
TTGTCAATTCTGAAAATGAATTCTTCTGAAGGGAGGAGAAAAGTCTTCTCTACATGTGGA
TCTCACCTCACTGCTGTGTCCATTTGTTATGGCACCAGCCTCTTTATGTATGTAAGACCT
AGTTCCAACTATTCACTGGAGCATGACATGATAGTGTCTATATTTTACACCATTGGGATT
CCCATGCTCAACCCCATCATCTACAGCCTGAGAAACAAAGATGTAAAAGAGGCGATGAAA
AGAGTTCTGAGAAAAATTTCAAAT


Conceptual translation

MKNITEATSFVLKGLTDNKELQIILFFLFLAVYLFTLIGNIGLIFLVVGDPQLHNPMYCF
LSALSSVDACYSSDITPNMLVGFVSNSKIISFHGCATQMFFAVTFGTTECFLLAAMAYDR
YEAIHNPLLYAVSMSPKVYVPLIVASYAGGILHAIIHTAPTFSLLF*QSNEIKHIFCDIP
PLLAISCSETYINEFLLLLFVSFIELVTILIILFSYAFIFLSILKMNSSEGRRKVFSTCG
SHLTAVSICYGTSLFMYVRPSSNYSLEHDMIVSIFYTIGIPMLNPIIYSLRNKDVKEAMK
RVLRKISN