Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5t15 Olfactory Receptor

Gene Symbol Or5t15
Organism Mouse
Family 5
Subfamily t
Pseudo No
Location chr2:86850773-86851696 (-)
Aliases Olfr1095, RP23-114J1.3, MOR179-1, RP23-114J1.3, MOR179-1

Sequence information


Nucleotide sequence

ATGAAAAACATCACAGAAGCTACTTTCTTTGTTCTCAAGGGACTCACAGACAACAATGAA
CTTCAGATCATTCTCTTTTTCCTCTTCCTAGCAATTTACCTTTTTACTCTAATAGGAAAT
GTAGGACTTATTATTTTAGTTGTTGGTGATCCCCAACTCCACAACCCTATGTACTGTTTC
CTCAGTGCATTGTCTTTTGTAGATGCTTGCTATTCTTCAGATATCACTCCAAATATGTTA
GTAGGCTTTATGTCTAAAAGCAAAATCATTTCATTTCATGGTTGTGCAACACAGATGTTT
CTTGCTGTTACATTTGGAACCACAGAATGTTTTCTTTTGGCAGCAATGGCTTATGACCGA
TATGTAGCCATTCACGACCCACTACTGTATGCAGTGAGCATGTCTCCTCGAGTCTATTTA
CCACTCATCATTGCTTCCTATGCTGGTGGAATTTTGCATGCTATTATCCACACAGTGGCC
ACTTTCAGCCTGTCTTTCTGTCAGTCCAATGAAGTCAAACATATATTCTGTGATATACCA
CCTCTACTTGCTATTTCCTGCTCTGAAACTTATGTAAATGAGCTCTTGCTCTTCTTCTTT
GTGAGTTTCATTGAGCTAGTCACCATCCTGATCATTCTGTTTTCCTATGCTTTTATCCTG
TTGTCAATCCTGAAGATGAATTCAGCTGAAGGGAGAAGAAAAGTCTTCTCTACATGTGGA
TCTCACCTCACTGCTGTGTCCATTTGTTATGGCACAAGCCTCTTCATGTATGTAAGACCT
AGTTCCAACTATTCCCTGGAGCATGACATGATCGTGTCAATATTTTATACCATTGGGATT
CCCATGCTCAACCCCATCATCTACAGTCTGAGAAACAAAGATGTAAAAGAGGCAATAAAA
AGAGTTTTGAGAAAAAATTTCATA


Conceptual translation

MKNITEATFFVLKGLTDNNELQIILFFLFLAIYLFTLIGNVGLIILVVGDPQLHNPMYCF
LSALSFVDACYSSDITPNMLVGFMSKSKIISFHGCATQMFLAVTFGTTECFLLAAMAYDR
YVAIHDPLLYAVSMSPRVYLPLIIASYAGGILHAIIHTVATFSLSFCQSNEVKHIFCDIP
PLLAISCSETYVNELLLFFFVSFIELVTILIILFSYAFILLSILKMNSAEGRRKVFSTCG
SHLTAVSICYGTSLFMYVRPSSNYSLEHDMIVSIFYTIGIPMLNPIIYSLRNKDVKEAIK
RVLRKNFI