Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5t16 Olfactory Receptor

Gene Symbol Or5t16
Organism Mouse
Family 5
Subfamily t
Pseudo No
Location chr2:86988245-86989174 (-)
Aliases Olfr1101, RP23-25M5.6, MOR179-3, RP23-25M5.6, MOR179-3

Sequence information


Nucleotide sequence

ATGGAGAATGTCACTGTGTCTCTTTTCATCCTGAGGGGCCTCACAGACAATGCTGAACTT
CAGATCAGTCTTTTTTTCTTATTTCTAATGATTTATCTTTTCACACTCATGGGAAACATA
GGACTGATCTCAGTAGTCATTGGGGATTCTCAGCTCCACAACCCAATGTACTATTTTCTA
GGTGTTTTATCATTCATAGATACTTGTTTTTCTACCATTATCACCCCCAAAATGCTAATA
GATTTTATGTCAAAGAGAAAAGTCATTTCATTCCTTGGATGTGTAGCACAGATGTTTCTT
GCTGTTAGCTGTGGAACCACAGAGTGTTTTCTCTTGGCTGCAATGGCTTATGACCGCTAT
GTAGCTATTTACAACCCACTTCTGTATGCAGTGAACATGTCACCCAGAGTCTACATGTCA
CTCATCATTGCCTCCAATGTTGGTGGTATTTTGCATGCATCTATCCATACAGCAGCCACT
GCTAGCTTGTCGTTTTGTGACTCTAATGAAATTAAGCATTTTTTCTGTGATATTCCCCCT
TTACTGGCTATTTCTTGCTCTGATACTAAAATGAATGAGCTTCTACTCTTCATCTTTGTG
AGCTCCATTGAGGTAGTCACTATCTTAATCATCATCGTCTCTTATAGTTTTATCCTGTTT
GCTATCTTGAAGATGCATTCTGCTGAGGGGAGGCAAAAAGTGTTCTCTACATGTGGCTCT
CACCTCACTGGCGTGTCCATATATTATGGAACAATCTTTTTCATGTATATGAGACCAAGT
TCCAGCTACACATTAGAGCATGACATGATAGTATCTACATTTTATGCCGTTGTCATCCCC
ATGCTGAATCCCATCATCTACAGTCTCAGGAACAAAGACGTAAAAAAGGCAATGAAAAGA
CTTTTAGCAAAAGTGTTTATGTCCATACGA


Conceptual translation

MENVTVSLFILRGLTDNAELQISLFFLFLMIYLFTLMGNIGLISVVIGDSQLHNPMYYFL
GVLSFIDTCFSTIITPKMLIDFMSKRKVISFLGCVAQMFLAVSCGTTECFLLAAMAYDRY
VAIYNPLLYAVNMSPRVYMSLIIASNVGGILHASIHTAATASLSFCDSNEIKHFFCDIPP
LLAISCSDTKMNELLLFIFVSSIEVVTILIIIVSYSFILFAILKMHSAEGRQKVFSTCGS
HLTGVSIYYGTIFFMYMRPSSSYTLEHDMIVSTFYAVVIPMLNPIIYSLRNKDVKKAMKR
LLAKVFMSIR