Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5t17-ps Olfactory Receptor

Gene Symbol Or5t17-ps
Organism Rat
Family 5
Subfamily t
Pseudo Yes
Location chr3:74585138-74585674 (+)
Aliases Olr534-ps, Olr534-ps

Sequence information


Nucleotide sequence

ATGAATGCAGAAATTAGCCAGGTGAATAATGTGAGTGAAATCACTGTCTTTATACTACTG
GGATTCACAGATGATGTTGACATGAACATATTTTTATTTATATTATTTCTTGCAATATAT
GTTGTAACTTTGATTGGAAATCTGGGATTGGTTGTATTGGTCATTGAGGATTTACGACTC
CATAACCCCATGTATTATTTTCTGACTGTTTTGTCATTATTGGATGCCTGCTTTTCTACA
GTACTGACTGCCAAAATGTTGGTCAATTTTCTTTCAAAAAACAAATCCATTTCACTTGTT
GGATGTGCAACACAGATGCTTCTCTTTGTTACATTTGGAACAACAGAATGCTTTCTTTTA
GCAGCAATGGCTTATGACCGCTACTTGGCAATCTACAGCCCACTTCTGTATGCAGTAAAG
ATGTCACCAAAAGTGTATGTACCACTCATTATTGCTTCCTATACTGGTGGAATTTTACAT
GCTACAATACACACAGTGGCTACTTTTAACCTGCCTTTCTGTGGATCTAATGAAATT


Conceptual translation

MNAEISQVNNVSEITVFILLGFTDDVDMNIFLFILFLAIYVVTLIGNLGLVVLVIEDLRL
HNPMYYFLTVLSLLDACFSTVLTAKMLVNFLSKNKSISLVGCATQMLLFVTFGTTECFLL
AAMAYDRYLAIYSPLLYAVKMSPKVYVPLIIASYTGGILHATIHTVATFNLPFCGSNEI\br/>NVFCDIPPLLALSCSDTHLNQLLLFYCAGSIELITILIVLVSYGFILLAILKIKLAEGRK
KVFSTCGAHLTGVSIFHGTILFMYVRPSSNYTLEHDMVVSTFYTIVIPMLNPIIYSLRNK
DVKEAMRKLLKKKLVHE