Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5t18 Olfactory Receptor

Gene Symbol Or5t18
Organism Mouse
Family 5
Subfamily t
Pseudo No
Location chr2:86806053-86806997 (-)
Aliases Olfr141, RP23-114J1.1, K17, MOR179-5

Sequence information


Nucleotide sequence

ATGAGGAACATCACAGAAGCTACTTTCTTTGTTCTCAAGGGACTCACAGACAACAATGAA
CTTCAGATCATTCTATTTCTCCTCTTTCTAGCAATTTACATTTTTACTCTGATAGGAAAT
GTAGGACTTATTATTTTAGTTGTTGGGGATTCTCAGCTCCACAACCCTATGTACTGTTTT
CTCAGTGTGTTATCTTCTGTAGATGCCTGTTATTCTACAGATATCACCCCAAATATGCTA
GTAGGCTTTATGTCTAAAAGCAAAATCATTTCATTTTATGGTTGTGCAACACAGATGTTT
CTTGCTGTTACATTTGGAACCACAGAATGCTTTCTTTTGGCAGCAATGGCTTATGACCGA
TATGTAGCCATTCATGACCCACTTCTGTATGCAGTGAGCATGTCTCCTCGAGTCTATATA
CCACTTATCATTGCATCCTATGCTGGTGGAATTGTGCATGCTATTATCCACACAGTGGCC
ACTTTCAGCCTGTCTTTCTGTCGGTCCAATGAAGTCAAACATATATTCTGTGATATACCA
CCTCTTCTTGCTATTTCCTGCTCTGAAACTTATGTAAATGAGCTCTTGCTCTTCTTCTTC
GTGAGTTTCATCGAGCTAGTCACCATTCTGATTGTCCTGGTCTCCTATGCTTTTATCCTG
TTGTCAATTCTGAAGATGAATTCATCTGAAGGGAGAAGAAAAGTCTTCTCTACATGTGGA
GCTCACCTCACTGCTGTGTCCATTTATTATGGCACAATCCTCTTCATGTATGTAAGACCT
AGTTCCAACTATTCCCTGGAGCATGACATGATAGTGTCTACATTTTATACCATTGGGATT
CCCATGCTCAACCCCATCATCTACAGTCTGAGAAACAAAGATGTAAAAGAGGCAATGAAA
AGAGTTTTGAGAAAAAAATTAATATTAAACATAGAATTAAAAAAT


Conceptual translation

MRNITEATFFVLKGLTDNNELQIILFLLFLAIYIFTLIGNVGLIILVVGDSQLHNPMYCF
LSVLSSVDACYSTDITPNMLVGFMSKSKIISFYGCATQMFLAVTFGTTECFLLAAMAYDR
YVAIHDPLLYAVSMSPRVYIPLIIASYAGGIVHAIIHTVATFSLSFCRSNEVKHIFCDIP
PLLAISCSETYVNELLLFFFVSFIELVTILIVLVSYAFILLSILKMNSSEGRRKVFSTCG
AHLTAVSIYYGTILFMYVRPSSNYSLEHDMIVSTFYTIGIPMLNPIIYSLRNKDVKEAMK
RVLRKKLILNIELKN