Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5t18 Olfactory Receptor

Gene Symbol Or5t18
Organism Rat
Family 5
Subfamily t
Pseudo No
Location chr3:74013863-74014879 (-)
Aliases Olr516, Olr516

Sequence information


Nucleotide sequence

ATGGACATATATACTGTCTCTTGTTATTATAGTACTATGGACCATAGCCTGAGTATCTTC
AAAATTGTTGCAGGAGATTCCAACATGAAGAACATCACAGAAGCTACTTCATTTATCCTC
AAGGGACTCACAGACAATATGGAACTTCAGATCATTCTCTTTTTTCTATTCTTAGCAATT
TACCTTTTTACTCTAATAGGAAATGTAGGACTTATTATCTTAGTTGTTGGAGATCCCCAG
CTCCACAACCCTATGTACTGTTTCCTTAGTGTGTTGTCTTCTGTAGATGCCTGCTATTCT
TCAGATATCACCCCAAATATGTTAGTAGGTTTTATGTCTAAAAGCAAAATAATTTCAATT
CATGGTTGTGCAACACAAATGTTCCTTGCTGTTACATTTGGAACCACAGAATGTTTTCTT
TTGGCAGCAATGGCATATGATCGATATGTAGCCATTCACAACCCACTTCTGTATGCAGTG
AGCATGTCTCCTCAAATCTATGTGCCACTTATCATTGCTTCCTATGCTGGTGGAATTGTG
CATGCTATTATCCACACAGTGGCCACTTTCAGACTGTCTTTCTGTCAGTCCAATGAAATC
AAACATATATTCTGTGATATACCTCCTCTACTTGCTATTTCCTGTTCTGAAACTTATATA
AATGAGCTCTTGCTTTTCTTCTTTGTGAGTTTCATAGAGCTAGTCACCATCCTCATTGTT
CTGATTTCCTATGCTTTCATCCTGTTGTCAATTCTGAAAATGAATTCTTCTGAAGGGAGA
AGGAAAGTCTTCTCTACATGTGGAGCTCACCTCACTGCGGTGTCCATTTTTTATGGCACA
ATCCTCTTCATGTATGTAAGACCTAGTTCTAACTATTCTCTGGAGCATGATATGATAGTG
TCTACATTTTACACCATTGGGATTCCCATGCTCAACCCCATCATCTACAGTCTGAGAAAC
AAAGATGTAAAAGAGGCAATGAAAAGACTTTTGAGAAAACATTTTCATATTAAACAT


Conceptual translation

MDIYTVSCYYSTMDHSLSIFKIVAGDSNMKNITEATSFILKGLTDNMELQIILFFLFLAI
YLFTLIGNVGLIILVVGDPQLHNPMYCFLSVLSSVDACYSSDITPNMLVGFMSKSKIISI
HGCATQMFLAVTFGTTECFLLAAMAYDRYVAIHNPLLYAVSMSPQIYVPLIIASYAGGIV
HAIIHTVATFRLSFCQSNEIKHIFCDIPPLLAISCSETYINELLLFFFVSFIELVTILIV
LISYAFILLSILKMNSSEGRRKVFSTCGAHLTAVSIFYGTILFMYVRPSSNYSLEHDMIV
STFYTIGIPMLNPIIYSLRNKDVKEAMKRLLRKHFHIKH