Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5t5 Olfactory Receptor

Gene Symbol Or5t5
Organism Mouse
Family 5
Subfamily t
Pseudo No
Location chr2:86785732-86786697 (+)
Aliases Olfr1093, RP23-449C14.7, MOR179-6, RP23-449C14.7, MOR179-6

Sequence information


Nucleotide sequence

ATGGAAAAGATCACATCAGCTGTGGATGTCCACAATATTCCATTAAAGAACATGACTGAA
GCCACCATGTTTATTCTCTTAGGATTCACAGATGACTTTGAACTCCAAGTCTTCCTGTTT
TTACTGTTTCTTGCTATTTATCTCTTCACTCTGGTAGGAAACTTTGGACTGGTTGTTTTG
GTCATTGGGGATTGTCGGCTACACAACCCCATGTACTATTTCCTAAGTGTTTTGTCTTTC
CTGGATGCTTGCTATTCTACAGTTGTTACACCCAAAATGTTGGTCAACTTTCTAAGTGAA
AATAAGTCCATTTCATTCCTTGCATGTGCAACCCAAATGCTTCTCTTTGTTTCGTTGGGA
ACCACAGAATGCTTTCTCCTGGCAGCAATGGCTTATGACCGATATGTAGCCATCTACAAC
CCACTTCTGTATACAGTGGCCATGTCACCCAGAGTATACCTGCCACTCATCATTGCTTCC
TATGCTGGTGGAGTTGTGCATGGTGCTATCCACACAGTGGCCACTTTCAGTCTGTCCTTC
TGTGGATCCAATGAAATTAAGCATGTCTTCTGTGACATCCCTGCATTGCTTGCTCTTTCT
TGTTCTGATACCCACACAAATGAGCTTCTAGTCTTGTACTTGGTGGGCTTGATTGAGATT
GTTACCATCCTGATTGTTCTGGTCTCCTATGGATTCATCCTCTTTGCCATTCTGAACATG
CATTCTGCTGAGGGTAGGAGGAAAGTGTTCTCTACATGTGGCTCTCACCTCACTGGAGTC
TCTATTTACCATGGTACAATCCTTTTCACTTATATGAGGCCTAGTTCCAGTTATGCTTCA
AATCATGACATGGTAGTGTCAATATTTTACACCATTGTGATACCCATGTTGAATCCTATC
ATCTATAGTTTGAGGAACAAAGATGTAAAAGTAGCATTTAATAAATTGTGGAGAAAATGT
GATTCA


Conceptual translation

MEKITSAVDVHNIPLKNMTEATMFILLGFTDDFELQVFLFLLFLAIYLFTLVGNFGLVVL
VIGDCRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLSENKSISFLACATQMLLFVSLG
TTECFLLAAMAYDRYVAIYNPLLYTVAMSPRVYLPLIIASYAGGVVHGAIHTVATFSLSF
CGSNEIKHVFCDIPALLALSCSDTHTNELLVLYLVGLIEIVTILIVLVSYGFILFAILNM
HSAEGRRKVFSTCGSHLTGVSIYHGTILFTYMRPSSSYASNHDMVVSIFYTIVIPMLNPI
IYSLRNKDVKVAFNKLWRKCDS