Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5t5 Olfactory Receptor

Gene Symbol Or5t5
Organism Rat
Family 5
Subfamily t
Pseudo No
Location chr3:73988939-73989907 (+)
Aliases Olr515, Olr515

Sequence information


Nucleotide sequence

ATGGAAATGATCACATCAGCTGTAGGTGTTGACAAGATTCCATTAGAGAACATGACTGAA
GCCACGATGTTTATACTCTTGGGCTTCACTGATGACTTTGAATTGCAAGTTTTCCTATTT
TTACTGTTTCTTGCTATTTATCTCTTCACTCTGATAGGAAATTTTGGACTGGTTATTTTG
GTCATTGGGGATTGTCGGCTACACAATCCCATGTACTATTTCCTAAGTGTTTTGTCTTTC
CTGGATGCCTGTTATTCTACAGTTGTTACCCCCAAAATGTTGGTCAACTTTCTAAATGAA
AATAAGTCCATTTCGTTCCTTGCATGTGCAACACAGATGCTTCTCTTTGTTACTTTAGGA
ACCACAGAATGCTTTCTGCTGGCAGCAATGGCATATGACAGATATGTAGCCATCTACAAC
CCACTTCTGTACACTGTAACAATGTCACCCAGAGTATATCTGCCACTCATCATTGCCTCC
TATACTGGTGGGGTTATGCATGGTGCTATACACACAGTGGCCACTTTCAGTCTGTCCTTC
TGTGGATCCAATGAAATAAGGCATGTCTTCTGTGACATCCCGGCATTGCTTGCTCTTTCT
TGTTCTGATACACGCACAAATGAACTTCTACTCTTGTACTTGGTGGGTTTGATTGAGATT
GTCACCATCCTGATTGTTCTGGTCTCCTATGGATTCATCCTCTTTGCCATTCTGAACATG
CATTCTACTGAGGGAAGGAGGAAAGTCTTCTCTACATGTGGCTCTCACCTCACTGGAGTC
TCTATTTACCATGGTACTATCCTTTTCAGTTATATGAGGCCTAGTTCCAGCTATGCTTCA
AATCATGACATGGTAGTTTCAATATTTTACACCATTGTGATACCCATGCTGAATCCTATC
ATCTACAGTTTGAGAAATAAAGATGTAAAAGAGGCAATGAAGAAATTGTGGAGAAATGTG
GTTCATAAT


Conceptual translation

MEMITSAVGVDKIPLENMTEATMFILLGFTDDFELQVFLFLLFLAIYLFTLIGNFGLVIL
VIGDCRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLNENKSISFLACATQMLLFVTLG
TTECFLLAAMAYDRYVAIYNPLLYTVTMSPRVYLPLIIASYTGGVMHGAIHTVATFSLSF
CGSNEIRHVFCDIPALLALSCSDTRTNELLLLYLVGLIEIVTILIVLVSYGFILFAILNM
HSTEGRRKVFSTCGSHLTGVSIYHGTILFSYMRPSSSYASNHDMVVSIFYTIVIPMLNPI
IYSLRNKDVKEAMKKLWRNVVHN