Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5t5b Olfactory Receptor

Gene Symbol Or5t5b
Organism Rat
Family 5
Subfamily t
Pseudo No
Location chr3:74341754-74342719 (-)
Aliases Olr519, Olr519

Sequence information


Nucleotide sequence

ATGAAAAGGATCATATCAGCTGTGGATGTCCACAAGATTCCCTTAGAGAATGTGACAGAA
GTAACTACGTTTATTCTCTTGGGCTTCACAGATGACTTTGAACTCCAGGTCTTCCTATTT
TTACTGTTTCTTGATATTTATCTTTTCACTCTGATAGGAAACTTTGGGCTGGTTGTTTTA
GTCATTGGGGATTGTCGACTACACAACCCCATGTACTATTTCCTCAGTGTTTTGTCTTTC
CTGGATGCCTGTTATTCTACAGCAGTTACCCCCAAAATGTTGGTTAACTTCCTAAATGAA
AATAAGTCCATTTCGCTCCTTGGATGTGCAACACAAATGCTTCTCTTTGTTAGTTTAGGG
ACCACAGAAAGCTTTCTGCTGGCAGCAATGGCATATGACAGATATGTAGCCATCTACAAC
CCACTTCTGTATGCTGTGATCATGTCACCCAGAGTTTACCTGCCACTCATCATTGCTTCC
TATGCTGGTGGAGTTGTGCATGGTGTTATTCACACAGTGGCCACTTTCAGTCTGTCCTTC
TGTGGATCCAATGAAATTAGGCATGTCTTCTGTGACATCCCAGCATTGCTTGCTCTTTCT
TGTTCTGATACACGCACAAATGAACTTCTACTCATGTACTTGGTGGGCTTGATTGAGGCA
GTCACCATCCTAATTGTTCTGGTTTCCTATGGATTAATCCTCTTTGCTATTCTGAACATG
CATTCTGCTGAGGGTAGAAGGAAAGTGTTCTCTACATGTGGCTCTCACCTCACTGGAGTC
TCTATTTACCATGGTACAATCCTTTTCAGTTATATGAAATCAAGTTCTAGCTATGCTTCA
AATCATGACATGGTAGTTTCAATATTTTACACCATTGTGATACCCATGCTGAATCCTATC
ATCTACAGTTTGAGGAACAAAGATGTAAAAGAGGCAATGAAGAAATTGTGGAGAAAGTGT
AGTTCA


Conceptual translation

MKRIISAVDVHKIPLENVTEVTTFILLGFTDDFELQVFLFLLFLDIYLFTLIGNFGLVVL
VIGDCRLHNPMYYFLSVLSFLDACYSTAVTPKMLVNFLNENKSISLLGCATQMLLFVSLG
TTESFLLAAMAYDRYVAIYNPLLYAVIMSPRVYLPLIIASYAGGVVHGVIHTVATFSLSF
CGSNEIRHVFCDIPALLALSCSDTRTNELLLMYLVGLIEAVTILIVLVSYGLILFAILNM
HSAEGRRKVFSTCGSHLTGVSIYHGTILFSYMKSSSSYASNHDMVVSIFYTIVIPMLNPI
IYSLRNKDVKEAMKKLWRKCSS