Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5t7 Olfactory Receptor

Gene Symbol Or5t7
Organism Mouse
Family 5
Subfamily t
Pseudo No
Location chr2:86676402-86677331 (-)
Aliases Olfr1086, RP23-449C14.3, MOR179-2, RP23-449C14.3, MOR179-2

Sequence information


Nucleotide sequence

ATGGAAAACATCACTGAAGTCACAGAATTTATACTGATGGGCTTTACAGACAATGCTGAC
CTGGAGATCCTTTCCTTCTTCCTCTTTCTAGCAATTTACCTCTTCACACTCATGGGAAAT
TTAGGACTGATTACTCTGGTCATTGGTGACTCCCGCCTGCACAATCCCATGTACTATTTT
CTGAGTGTGCTGTCCTCAGTAGACGCCTGCTATTCTACTGTTATCACCCCACAAATGGTA
GTTGACTTTGTGTCAGAGAAGAAAGTCATTTCATTCATTGGCTGTGCCACACAGATGTTT
CTGGCTGTGACTTTTGGTACAACTGAATGTTTTCTTTTGGCAGCAATGGCTTATGACCGC
TATGTGGCCATTCACAACCCTCTTATGTATGTAGTGAGCATGTCACCAAGAGTCTATGTG
CCACTCATCATTGCTTCCTATGCTGGTGGAATTTTACATGCTGTTATTCACACGGTGGCT
ACTTTCAGACTCTCTTTTTGTGGATCCAATAAAATCAGTCATATTTTCTGTGACATCCCT
CCTCTCCTGGCAATTTCATGTTCTGACACCCACTTCAATCAGCTTCTCCTCTTCTATTGT
GCTGGGTTTATTGAGGTAGTCACTATCCTGATTGTCCTGCTGTCCTATGGCTTCATTTTG
TCTGTCATTTTGAAGACACGCTCTACTGAAGGTAAAAGAAAAGTCTTTTCTACATGTGGC
TCACACCTAATGGCAGTGTCCACATTTCATGGCACTGTTCTTTTCATGTATGTGAGACCA
AGTGACAGCTATGCCTTGGAACATGACATGATGGTATCAATATTTTACAGCATTGTAATC
CCAATGCTGAATCCTCTCATTTATAGTTTGAGGAACAAAGATGTAAAAGAGGCAATAAAA
AAAGTTTTTGGAAAAAGAATACTTTGTGGA


Conceptual translation

MENITEVTEFILMGFTDNADLEILSFFLFLAIYLFTLMGNLGLITLVIGDSRLHNPMYYF
LSVLSSVDACYSTVITPQMVVDFVSEKKVISFIGCATQMFLAVTFGTTECFLLAAMAYDR
YVAIHNPLMYVVSMSPRVYVPLIIASYAGGILHAVIHTVATFRLSFCGSNKISHIFCDIP
PLLAISCSDTHFNQLLLFYCAGFIEVVTILIVLLSYGFILSVILKTRSTEGKRKVFSTCG
SHLMAVSTFHGTVLFMYVRPSDSYALEHDMMVSIFYSIVIPMLNPLIYSLRNKDVKEAIK
KVFGKRILCG