Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5t7 Olfactory Receptor

Gene Symbol Or5t7
Organism Rat
Family 5
Subfamily t
Pseudo No
Location chr3:73878718-73879647 (-)
Aliases Olr510, Olr510

Sequence information


Nucleotide sequence

ATGGAAAACATCACTGAAGTCACAGAATTTATACTGAAGGGCTTCACAGACAATGCTGAC
CTGGAGATCCTTTCCTTCTTCCTCTTTCTAGCAATTTACCTCTTCACACTCATGGGAAAT
ATAGGACTAATTGCTCTGGTCATTGGTGATTCCCGCCTGCACAACCCCATGTACTATTTT
CTGAGTGTGTTGTCCTCCGTAGATGCCTGCTATTCTTCTGTTATCACACCACAAATGGTA
GTTGACTTTCTGTTAGAAAAGAAAGTCATTTCGTTCATTGGCTGTGCCACACAGATGTTT
CTGGCTGTGACTTTTGGCACAACTGAATGCTTTCTTTTGGCAGCAATGGCTTATGACCGC
TATGTGGCTATTCACAATCCTCTTCTATATGTAGTGAGCATGTCACCAAGAGTATATGTA
CCACTCATCATTGCATCCTATGCTGGTGGAATTTTACATGCTGTTATTCACACTGTGGCC
ACTTTCAGACTCTCATTTTGTGGATCCAATGAAGTTAGTCATATTTTCTGTGACATCCCT
CCTCTCCTGGCAATTTCTTGTTCGGACACCCACATCAATCAGCTTCTCCTCTTCTACTGT
GCTGGGTTTATTGAGGTAGCCACTATCCTGATTGTACTGTTATCATATGGTTTCATTCTG
TCTGCTATTCTGAAGACACGCTCTATTGAAGGTAAAAGAAAAGTCTTCTCTACATGTGGT
TCTCACTTAACGGCAGTGTCTACGTTTCATGGCACTGTTCTTTTCATGTATGTAAGACCA
AGTGCTAGTTATGCATTGGAACATGACATGGTAGTGTCAATATTTTACAGCATTGTAATT
CCAATGCTGAATCCTCTCATTTATAGTTTGAGGAACAAAGATGTTAAAGAGGCAATAAAA
AAAGTGTTTGGTAAAAGACTAATTTGTGGA


Conceptual translation

MENITEVTEFILKGFTDNADLEILSFFLFLAIYLFTLMGNIGLIALVIGDSRLHNPMYYF
LSVLSSVDACYSSVITPQMVVDFLLEKKVISFIGCATQMFLAVTFGTTECFLLAAMAYDR
YVAIHNPLLYVVSMSPRVYVPLIIASYAGGILHAVIHTVATFRLSFCGSNEVSHIFCDIP
PLLAISCSDTHINQLLLFYCAGFIEVATILIVLLSYGFILSAILKTRSIEGKRKVFSTCG
SHLTAVSTFHGTVLFMYVRPSASYALEHDMVVSIFYSIVIPMLNPLIYSLRNKDVKEAIK
KVFGKRLICG