Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5t9 Olfactory Receptor

Gene Symbol Or5t9
Organism Mouse
Family 5
Subfamily t
Pseudo No
Location chr2:86828754-86829743 (+)
Aliases Olfr1094, RP23-114J1.2, MOR179-7, RP23-114J1.2, MOR179-7

Sequence information


Nucleotide sequence

ATGTCGATACATTCACCAGGTTACACTGTACGAAGAATTCCAGTGAACAATGTGACAGAC
ACCACCATGTTTATACTAACAGGCTTCACTGATGACGCTGACCTGCAAGTCTTGTTATTT
CTTCTGTTTTTTGTGATTTATCTTTTTACTCTCATAGGCAACTTAGGACTTGTTTTGCTT
GTCATTGGAGATTCCCGGCTTCACAATCCAATGTATTATTTTTTAAGTGTTTTATCATTC
CTAGATGCCTGTTATTCCACCGTTGTCACTCCGAAGATGTTGGTCAATTTTATTTCAAAT
GATAAATCTATTTCATACCCTGGTTGTGTAACAGAGATGTTTCTCTTTGTTACGTTTGGA
ACCACAGAATGCTTCCTGTTGGCAGCAATGGCTTATGATCGCTTTGTAGCTATCTACAAT
CCACTTCTGTATGCAGTGAAAATGTCACCTAGAGTCTACATACCTCTCATTATAGCTTGT
TATTCAGGAGGGATTATGCATGCTACTATACATACAGTGGCTACCTTTAGCCTTTCTTTC
TGTGCATCCAATGAGATTAGGCATGTCTTCTGTGATATTCCTCCATTGCTTGCTATTTCT
TGTTCAAACACAAATATAAATCAGCTTCTGCTCTTCTATTGTGTAGGCTCCATTGAGATC
ATCACCATCCTGATTGTCCTGGTCTCTTACAGTTTCATACTCTTTGCAATTCTTAAGATG
AATTCTGCAGAAGGGAGGAGAAAAATATTCTCTACATGTGGTTCTCACCTTACAGGAGTG
TCCATTTATCATGGGACAATTCTTTTCATGTATGTGAGACCTAGTTCCAACTATGCCTTG
GAACATGACATGATTGTGTCCACATTTTATACCATTGTGATTCCAATGCTGAATCCTATC
ATCTACAGTCTGAGAAACAAAGATGTAAAAGAGGCAATGAAAAAGATTTTTGAGAGAAAT
TTCTTCATGAACAAAGTGCATTTTAAATTA


Conceptual translation

MSIHSPGYTVRRIPVNNVTDTTMFILTGFTDDADLQVLLFLLFFVIYLFTLIGNLGLVLL
VIGDSRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFISNDKSISYPGCVTEMFLFVTFG
TTECFLLAAMAYDRFVAIYNPLLYAVKMSPRVYIPLIIACYSGGIMHATIHTVATFSLSF
CASNEIRHVFCDIPPLLAISCSNTNINQLLLFYCVGSIEIITILIVLVSYSFILFAILKM
NSAEGRRKIFSTCGSHLTGVSIYHGTILFMYVRPSSNYALEHDMIVSTFYTIVIPMLNPI
IYSLRNKDVKEAMKKIFERNFFMNKVHFKL