Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5t9b Olfactory Receptor

Gene Symbol Or5t9b
Organism Rat
Family 5
Subfamily t
Pseudo No
Location chr3:74,370,400-74,371,500 (-)
Aliases Olr518

Sequence information


Nucleotide sequence

ATGGTGATGGTGGACACAGTTCTCATAAAGCACTGTTTTTATGTGGTATATGAGTCAGAG
ATGTCGAGGCATCCACTAGGTTACAGTGTACAAAGATTTCCAATGAAAAATGTGACAGAC
ATCACCATGTTTATATTAACAGGTTTCACTGGTGATGCTGACATGCAAGCCTTGTTATTT
ATTTTGGTTTTTGTGATCTATCTTTTTACTCTTATAGGCAACTTGGGACTTGTTTTGCTA
GTCATTGGAGATTCCCGCCTTCACAATCCCATGTACTATTTTTTAAGTGTTCTATCATTT
CTAGATGCCTGTTATTCCACAGTTGTCACTCCAAAGATGTTGGTCAATTTTCTTTCAAAA
GATAAATCTATCTCATACCCTGGTTGTGTGACAGAGTTGTTTCTCTTAGTTACATTTGGA
ACCACAGAATGTTTCCTGTTGGCAGCAATGGCTTATGACCGCTATGTAGCTATCTACAAC
CCACTTCTCTATGCAGTGAAAATGTCACCTACTGTCTATATACCTCTCATCATAGCTTGT
TATTCAGGTGGAATTATGCATGCTACTATACACACAGTGGCTACCTTTAGCCTTTCTTTC
TGTGCATCCAATGAAATTAGGCATGTCTTCTGTGACATTCCTCCATTGCTGGCTATTTCT
TGTTCAAACACCAATATAAACCAGCTTCTGCTCTTCTATTGTGTGGGAGCCATCGAAATT
ATTACCATCCTGATTGTCCTGGTTTCTTACAGTTTCATACTCTTTGCAATTCTTAAGATG
CGTTCTGCAGAAGGGAGGAGAAAAATCTTTTCTACATGTGGTTCTCACCTTACAGGAGTG
CCAATTTATCATGGGACAATTCTTTTCATGTATGTGAGACCTAGTTCTAACTATGCCTTG
GAACATGACATGATTGTGTCCACATTTTATACTATTGTGATTCCAATGCTAAATCCCATC
ATCTACAGTCTGAGAAACAAAGATGTGAAAGAGGCAATGAAAAAGATTTTTGAGAGAAAT
TTGTTCATGAATAAAGTTCATCTTAAATTC


Conceptual translation

MVMVDTVLIKHCFYVVYESEMSRHPLGYSVQRFPMKNVTDITMFILTGFTGDADMQALLF
ILVFVIYLFTLIGNLGLVLLVIGDSRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLSK
DKSISYPGCVTELFLLVTFGTTECFLLAAMAYDRYVAIYNPLLYAVKMSPTVYIPLIIAC
YSGGIMHATIHTVATFSLSFCASNEIRHVFCDIPPLLAISCSNTNINQLLLFYCVGAIEI
ITILIVLVSYSFILFAILKMRSAEGRRKIFSTCGSHLTGVPIYHGTILFMYVRPSSNYAL
EHDMIVSTFYTIVIPMLNPIIYSLRNKDVKEAMKKIFERNLFMNKVHLKF