Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5u1-ps Olfactory Receptor

Gene Symbol Or5u1-ps
Organism Mouse
Family 5
Subfamily u
Pseudo Yes
Location chr19:13158191-13159313 (+)
Aliases Olfr1460-ps1, MOR202-31P, MOR202-31P

Sequence information


Nucleotide sequence

ATGACAATGATGGAGAACAGAACAGAAGTGACACAGTTCATCCTTTCAAGACTCACTGAT
GACCCAAGTCTGCAGCTTCCCCTCTTCATCACCTTCCTCCTCATCTACATCCTCATCCTG
GGGATGATCCTACTTTTTATTCTGGATTCTTGGCTCTACATCCCCATGTACTTTTTCCTG
GGTAATCCTTCCCTTGGTGATCTCAGTTACTCTTCATATATCACTCCCAAAGTCATGGAT
GAGCTCTTTAATAGGAGACAACGTCTCCTATGTCTTACAATGACTGTGCTGATCAGATGT
TCTTTGCTGCAGGCTTTGCTTCTGTGGAAAATTATCTGTAAGCCTCAGCTGGCTATGATT
GCTATGCAAAACTGTGTAAGCTATTACACCATGCCACCTTAATTACTAAAGGAGTGTTTG
TATATATAATCATAAACTGTTACATATTTGACTTCATGAAAGATTTTTTTGTTGTTGTTT
TTTTGAGACAGGGTTTCTCTGTATAGCCCTAGCTGTCCTGGAACTCACTCTGTAGACCAG
GATGGCCTCAAACTCTGAAATCCACCTGCCTCTGCCTCCCAAGTACTGGGATTAAAGGTG
TGTGCCATCACTGCCTCTCCATGAATGAATTTTTATTCATTGGAGATACTTGTATCAGTT
CAGTTTCTACTTCTGTAAATTTAATGTGATTTACCATTTATTCTTTTATATGCCAGCCAT
CATGTATGTCTCTTGATCTGATAGACATGTGAATGAGCTGGTTTCTGTTTGTCTAGCCAG
CTTCAATATCTTTTTTTGCTCTCATAATTATCTATTATCTCATATTATTATTTTCATTGG
TATCCTAAGAATGCACTCAGGTACAGGCCATCAGAAGTCTATATCCACCTGTGCTTCCCA
TATAATTCCTGTCACTGCATTCTATGGGACTCTTATCTTCATGTACTTACAATCCAGTTC
CAGTCATGCAATGAACACTGACAAAACTGTATCTGTGTTTTATACTATGGTCATCCCTAT
GTTTAATCCTGTGGTCTATAGTTTGAGGAACAAGTAGATCAAAGTAGCATTCAGAAAAAT
TGTTCTGATGGAAAAAAAGCTTTTTGTTTATAACTTTAACATT


Conceptual translation

MTMMENRTEVTQFILSRLTDDPSLQLPLFITFLLIYILILGMILLFILDSWLYIPMYFFL
GNPSLGDLSYSSYITPKVMDELFNRR/TSPMSYNDCADQMFFAAGFASVENYL*ASAGY
DCYAKLCKLLHHATLITKGVFVYIIINCYIFDFMKDFFVVVFLRQGFS/IALAVLELTL
*TRMASNSEIHLPLPPKYWD*RCVPSLPLHE*IFIHWRYLYQFSFYFCKFNVIYHLFFYM
PAIMYVS*SDRHVNELVSVCLASFNIFFCSHNYLLSHIIIFIGILRMHSGTGHQKSISTC
ASHIIPVTAFYGTLIFMYLQSSSSHAMNTDKTVSVFYTMVIPMFNPVVYSLRNK*IKVAF
RKIVLMEKKLFVYNFNI