Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w11 Olfactory Receptor

Gene Symbol Or5w11
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87628465-87629391 (+)
Aliases Olfr1131, RP23-463G15.7, MOR177-4, RP23-463G15.7, MOR177-4

Sequence information


Nucleotide sequence

ATGGATATAGGAAACTGTTCCTTGAATGAATTCATTTTTGTGGGAGTTACCAATAACCCA
GAGATGAAAGGGACGCTGTTTACCATATTTCTCCTCATCTATCTCATCAATCTTCTGGGG
AATATTGGAATGATCATTTTGATCAGAATGGATCCTCAGCTGCATACACCCATGTACTTT
TTCCTGAGCCACCTGTCTTTCTGTGATCTTTGCTATTCCACAGCAATTGGTCCCAAGATG
CTGCTAGATATGTTTGGCAAGAACAAGTCAATTCCTTTCTGGGGCTGTGCTCTGCAGCTC
TTCATTTTCTGTGTCTTTGCAGATTCTGAGTGTGTGCTGCTGGCAGTCATGGCCTTTGAT
AGATACCAGGCCATTAGCAACCCCTTGCTCTACACAGCAAACATGTCCAGCAGGAAGTGT
TTCATGTTCATGGCTGGAGTTTACCTGGTGGGAACATCAGATGCTTTGATACATACAACT
TTGGCATTCCGCTTGTGTTTCTGCGGGTCTAATGAGATCAACCACTTCTTCTGTGATCTA
CCTCCACTTTACCTTCTCTCCTGCTTAGATACTCAAGTAAATTACCTGGCACTATTTACT
ATTTATGGCTTCCTTGAACTGAGCACCATCTCAGGAGTCCTTGTTTCTTACTGTTACATC
ATCTCATCAATCTTAAAAATCCGTTCAGCTGAAGGGAGATTTAAAGCTTTCTCCACCTGC
ACCTCTCACTTGACTGCAGTTGCTATTTTTCAAGGAACTCTACTCTTCACATATTTTCGA
CCAAGTTCTTCTTATTCCCTTGATCAAGACAAAATGACATCTCTATTTTATACCCTTGTG
ATTCCTATGCTGAACCCACTGATTTATAGTTTAAGGAACAAGGATGTGAAAGAGGCCTTG
AAGAAAATTAAAAGAAAAAGATGGTTT


Conceptual translation

MDIGNCSLNEFIFVGVTNNPEMKGTLFTIFLLIYLINLLGNIGMIILIRMDPQLHTPMYF
FLSHLSFCDLCYSTAIGPKMLLDMFGKNKSIPFWGCALQLFIFCVFADSECVLLAVMAFD
RYQAISNPLLYTANMSSRKCFMFMAGVYLVGTSDALIHTTLAFRLCFCGSNEINHFFCDL
PPLYLLSCLDTQVNYLALFTIYGFLELSTISGVLVSYCYIISSILKIRSAEGRFKAFSTC
TSHLTAVAIFQGTLLFTYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEAL
KKIKRKRWF