Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w13 Olfactory Receptor

Gene Symbol Or5w13
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87692951-87693880 (-)
Aliases Olfr1136, RP23-463G15.14, MOR177-3, RP23-463G15.14, MOR177-3

Sequence information


Nucleotide sequence

ATGGACAAGAGAAACTGCTCATCTGTGCCTGAGTTTCTTCTGTTGGGAATTACCAATAAG
CCTGAAATGAAAGTTGCTTTGTTCATAGTGTTTCTCATTGTTTACCCCACTATTCTTCTG
ACAAACGTAGGAATGATCACATTGATCAGAATGGATCCCCAGCTTCACATACCAATGTAT
TTCTTCCTCAGCCACCTCTCATTCTCTGATCTCTGCTACTCCACTGCAGTTGGACCCAAG
ATGCTCTTAGACCTCCTTGAAGATAATAATCCAATTTCTTTTGTTGGCTGTTTTCTCCAA
CTCCTGATTGTCTCAATTTTTATAGATGTTGAATGCATGCTGCTGGCGGTGATGGCCTTT
GATAGATACAAGGCCATCAGCAACCCCCTTATGTATGCTGTGGACATGTCTAGTAGAGTT
TGTTACCAGTTTTTAACTGCAATCTATGTGTTTGGAACTATAGATGGTTTCATACATACC
TCATTGGCATTCAGCTTATGTTTCTGCCACTCTACTCAGATCAATCATTTATTTTGTGAT
TTACCTCCAGTCTTGCTTCTTTCATGTTCTGATACACATATCAATGAACTGGTATTATTT
ATGCTTTTTGGTTTCATTGAACTAAGCACCATCTCAGGAGTTCTTGTATCCTACTGTTAC
ATCATCTCATCTGTCTTAAAGATTAGTTCTACTGGTGGGTGGTTCAAAGCTTTCTCCACC
TGTGCCTCTCATCTGACTGCAGTTGGAATTTTCCAGGGGACTATGCTCTTCATGTATTTC
AGACCAAGCTCTGCCTACTCTCTAGATCAAGATAAAATGACATCCATATTTTACCTCCTT
GTTATCCCTATGATAAACCCTCTGATTTATAGTCTACGCAATAAAGATGTAAAAGAAGCA
TTGGTCAGGCTCAGAAGTAAATGGTGGTTT


Conceptual translation

MDKRNCSSVPEFLLLGITNKPEMKVALFIVFLIVYPTILLTNVGMITLIRMDPQLHIPMY
FFLSHLSFSDLCYSTAVGPKMLLDLLEDNNPISFVGCFLQLLIVSIFIDVECMLLAVMAF
DRYKAISNPLMYAVDMSSRVCYQFLTAIYVFGTIDGFIHTSLAFSLCFCHSTQINHLFCD
LPPVLLLSCSDTHINELVLFMLFGFIELSTISGVLVSYCYIISSVLKISSTGGWFKAFST
CASHLTAVGIFQGTMLFMYFRPSSAYSLDQDKMTSIFYLLVIPMINPLIYSLRNKDVKEA
LVRLRSKWWF