Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w13 Olfactory Receptor

Gene Symbol Or5w13
Organism Rat
Family 5
Subfamily w
Pseudo No
Location chr3:75848904-75849833 (+)
Aliases Olr583, Olr583

Sequence information


Nucleotide sequence

ATGGACAATAGAAACTGCACATCTGTACCTGAATTTCTTCTGTTGGGAATTACCAACAAG
CCTGAGATGAAAGTCGCTTTGTTCACAGTGTTTCTGATAGTTTATCTCACTATTCTTCTG
ACAAATGTAGGAATGATCACACTGATCACAATGGATCCCCAGCTTCACACACCAATGTAC
TTCTTTCTCAGCCACCTCTCATTCTCTGACCTCTGTTATTCAACTGCTGTTGGACCCAAG
ATGCTGTTAGATCTTCTTGAAGATAATAATCCAATTTCTTTTGTGGGCTGTTTTCTTCAA
CTCCTGATTGTTTCTATTTTTATAGATGTTGAATGCATGCTGCTGGCGGTGATGGCCTTT
GATAGGTACAAGGCCATCAGCAACCCCCTGATGTATACTGTGGACATGTCTAGTAGAGTA
TGTTACCAGTTCTTAACTGGAATATATCTGTTGGGAACTATAGATAGTTTCATACATACC
TCATTGGCATTCAGCTTGTGTTTCTGCCACTCTACTCAGATTAATCATTTCTTTTGTGAT
TTGCCTCCAGTCTTACTTCTTTCATGTTCTGATACGCATGTCAATGAACTGGTATTATTT
ACTCTTTTTGGTTTCATTGAACTAAGCACAATTTCAGGGGTTCTTGTATCCTACTGTTAC
ATTATCTCATCTGTCTTAAAGATCAGTTCTACTGGTGAGTGGTTCAAAGCTTTCTCCACC
TGTGCATCCCACCTGACTGCAGTAGGGATTTTCCAGGGGACCATGCTCTTCATGTACTTC
AGACCAAGTTCTGCATACTCTCTAGACCAAGATAAAATGACATCAGTTTTTTACCTCCTC
ATTATCCCCATGATAAACCCCCTGATTTACAGCCTAAGGAACAAGGATGTAAAAGAAGCC
CTGGTCAGGCTCAGAAGTAAAAGGTGGCTT


Conceptual translation

MDNRNCTSVPEFLLLGITNKPEMKVALFTVFLIVYLTILLTNVGMITLITMDPQLHTPMY
FFLSHLSFSDLCYSTAVGPKMLLDLLEDNNPISFVGCFLQLLIVSIFIDVECMLLAVMAF
DRYKAISNPLMYTVDMSSRVCYQFLTGIYLLGTIDSFIHTSLAFSLCFCHSTQINHFFCD
LPPVLLLSCSDTHVNELVLFTLFGFIELSTISGVLVSYCYIISSVLKISSTGEWFKAFST
CASHLTAVGIFQGTMLFMYFRPSSAYSLDQDKMTSVFYLLIIPMINPLIYSLRNKDVKEA
LVRLRSKRWL