Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5w14b Olfactory Receptor

Gene Symbol Or5w14b
Organism Rat
Family 5
Subfamily w
Pseudo No
Location chr3:75793290-75794183 (+)
Aliases Olr579-ps, Olr579-ps

Sequence information


Nucleotide sequence

ATGGAGAAAAAAATGGATAAAGGAAACTGTTCTTCATTGCCAGAATTCTTTCTCTTGGGA
ATTAGTATTAAGTATGATGTGAAGGTGGTTTTATTTGTGGTGTTTCTGCTTCTTTATCTC
ACTATTTTGCTGGAAAACTTGGGAATAACCATATTGATCAGAATGGATTCTCAACTTCAC
ACACCAATGTACTTCTTCCTCAGCCACCTCTCTTTCTCTGACCTCTGCTATTCCACTGCA
GTTGGACCCAGGATGCTGGTAGACCTGGTAGCCAAGAAACATTCAATTCCCTTTATGGGC
TGTTTTCTGCAGCTCTTGTTTGTCTATGTCTTTATAGATGTTGAATGCATGCTGCTGGCA
GTGATGGCTTTTGATAGATACAAGGCCATCAGCAACCCACTTTTGTATGCTGTGGACATG
TCCACCAAGGTGTGCTACCAGTTTTTAACTTTAATTTACATGGGAAGTGCTATAGATGGT
TTGATGCATACAACATTGGCATTTAGTTTATGTTTTTGTGGCTCTACTGAGATCAATCAT
TTTTTCTGTGATTTACCACCACTATTCCTCCTTTCCTGTTCTGACACACAAACAAATGAG
CTGGTTGTATTTACTCTTTTTGGTTTCATTGAACTGAGCACCATCTCGAGTGTCTTGGTC
TCTTATTGTTACATCATCTCATCAGTCTTAAAGATCAGCTCTGCAGGGGGACGCTTCAAA
GCTTTCTCCACCTGTGCTTCCCACCTTACTGCAGTTGGAATTTTCCAGGGGACAATGCTC
TTCATGAATTTCAGACCAAGTTCTGCCTACTCTCTAGACCAAGACAAAATACTGTCAGTC
TTCTACCTCCTCATTATCCCGATGATGAACCCTCTGATTTACGGAATAAGGATG


Conceptual translation

MEKKMDKGNCSSLPEFFLLGISIKYDVKVVLFVVFLLLYLTILLENLGITILIRMDSQLH
TPMYFFLSHLSFSDLCYSTAVGPRMLVDLVAKKHSIPFMGCFLQLLFVYVFIDVECMLLA
VMAFDRYKAISNPLLYAVDMSTKVCYQFLTLIYMGSAIDGLMHTTLAFSLCFCGSTEINH
FFCDLPPLFLLSCSDTQTNELVVFTLFGFIELSTISSVLVSYCYIISSVLKISSAGGRFK
AFSTCASHLTAVGIFQGTMLFMNFRPSSAYSLDQDKILSVFYLLIIPMMNPLIYGIRM